Iright
BRAND / VENDOR: Proteintech

Proteintech, 66466-1-Ig, JAK1 Monoclonal antibody

CATALOG NUMBER: 66466-1-Ig
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The JAK1 (66466-1-Ig) by Proteintech is a Monoclonal antibody targeting JAK1 in WB, IHC, ELISA applications with reactivity to human, rat, mouse samples 66466-1-Ig targets JAK1 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, rat, mouse samples. Tested Applications Positive WB detected in: K-562 cells, Jurkat cells, rat spleen tissue, PC-12 cells, NIH/3T3 cells, RAW 264.7 cells, Ramos cells, Daudi cells Positive IHC detected in: human breast cancer tissue, human cervical cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Immunohistochemistry (IHC): IHC : 1:100-1:400 Background Information Janus kinase 1(JAK1), is a member of a class of protein-tyrosine kinases (PTK) characterized by the presence of a second phosphotransferase-related domain immediately N-terminal to the PTK domain. JAK1 is essential for signaling for certain type I and type II cytokines. JAK1 plays a critical role in initiating responses to multiple major cytokine receptor families. Expression of JAK1 in cancer cells enables individual cells to contract, potentially allowing them to escape their tumor and metastasize to other parts of the body. Specification Tested Reactivity: human, rat, mouse Cited Reactivity: human, mouse, rat Host / Isotype: Mouse / IgG2b Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag17940 Product name: Recombinant human JAK1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 8-363 aa of BC132729 Sequence: EDCNAMAFCAKMRSSKKTEVNLEAPEPGVEVIFYLSDREPLRLGSGEYTAEELCIRAAQACRISPLCHNLFALYDENTKLWYAPNRTITVDDKMSLRLHYRMRFYFTNWHGTNDNEQSVWRHSPKKQKNGYEKKKIPDATPLLDASSLEYLFAQGQYDLVKCLAPIRDPKTEQDGHDIENECLGMAVLAISHYAMMKKMQLPELPKDISYKRYIPETLNKSIRQRNLLTRMRINNVFKDFLKEFNNKTICDSSVSTHDLKVKYLATLETLTKHYGAEIFETSMLLISSENEMNWFHSNDGGNVLYYEVMVTGNLGIQWRHKPNVVSVEKEKNKLKRKKLENKHKKDEEKNKIREEW Predict reactive species Full Name: Janus kinase 1 (a protein tyrosine kinase) Calculated Molecular Weight: 1154 aa, 133 kDa Observed Molecular Weight: 133 kDa GenBank Accession Number: BC132729 Gene Symbol: JAK1 Gene ID (NCBI): 3716 RRID: AB_2881834 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P23458 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924