Proteintech, 66470-2-Ig, Caspase 3/P17/P19 Monoclonal antibody

Size: 20ul / 150ul The Caspase 3/P17/P19 (66470-2-Ig) by Proteintech is a Monoclonal antibody targeting Caspase 3/P17/P19 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse samples 66470-2-Ig targets Caspase 3/P17/P19 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: Jurkat cells, HEK-293 cells, NIH/3T3 cells, HepG2 cells, HeLa cells Positive IHC detected in: human breast cancer tissue, mouse liver tissue, mouse kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:3000 Immunohistochemistry (IHC): IHC : 1:150-1:600 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information Caspases, a family of endoproteases, are critical players in cell regulatory networks controlling inflammation and cell death. Initiator caspases (caspase-2, -8, -9, -10, -11, and -12) cleave and activate downstream effector caspases (caspase-3, -6, and -7), which in turn execute apoptosis by cleaving targeted cellular proteins. Caspase 3 (also named CPP32, SCA-1, and Apopain) proteolytically cleaves poly(ADP-ribose) polymerase (PARP) at the beginning of apoptosis. Caspase 3 plays a key role in the activation of sterol regulatory element binding proteins (SREBPs) between the basic helix-loop-helix leucine zipper domain and the membrane attachment domain. Caspase 3 can also form heterocomplex with other proteins and performs the molecular mass of 50-70 kDa. This antibody can recognize p17, p19 and p32 of Caspase 3. Specification Tested Reactivity: human, mouse Cited Reactivity: human, mouse, rat, pig, canine, chicken, plant Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag25029 Product name: Recombinant human CASP3 protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 31-176 aa of BC016926 Sequence: ISLDNSYKMDYPEMGLCIIINNKNFHKSTGMTSRSGTDVDAANLRETFRNLKYEVRNKNDLTREEIVELMRDVSKEDHSKRSSFVCVLLSHGEEGIIFGTNGPVDLKKITNFFRGDRCRSLTGKPKLFIIQACRGTELDCGIETDS Predict reactive species Full Name: caspase 3, apoptosis-related cysteine peptidase Calculated Molecular Weight: 277 aa, 32 kDa Observed Molecular Weight: 32-35 kDa, 19 kDa, 17 kDa GenBank Accession Number: BC016926 Gene Symbol: Caspase 3 Gene ID (NCBI): 836 RRID: AB_2876892 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: P42574 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.