Iright
BRAND / VENDOR: Proteintech

Proteintech, 66475-1-Ig, Thioredoxin Monoclonal antibody

CATALOG NUMBER: 66475-1-Ig
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The Thioredoxin (66475-1-Ig) by Proteintech is a Monoclonal antibody targeting Thioredoxin in WB, IHC, IF/ICC, ELISA applications with reactivity to Human samples 66475-1-Ig targets Thioredoxin in WB, IHC, IF/ICC, ELISA applications and shows reactivity with Human samples. Tested Applications Positive WB detected in: LNCaP cells, MCF-7 cells, HeLa cells, HepG2 cells, A549 cells, Jurkat cells, HEK-293 cells, K-562 cells Positive IHC detected in: human ovary tumor tissue, human liver cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:1000-1:4000 Immunofluorescence (IF)/ICC: IF/ICC : 1:400-1:1600 Background Information TXN, TRDX, TRX, TRX1, ADF and SASP, belongs to the thioredoxin family. It participates in various redox reactions through the reversible oxidation of its active center dithiol to a disulfide and catalyzes dithiol-disulfide exchange reactions. TXN plays a role in the reversible S-nitrosylation of cysteine residues in target proteins, and thereby contributes to the response to intracellular nitric oxide. Nitrosylates the active site Cys of CASP3 in response to nitric oxide (NO), and thereby inhibits caspase-3 activity. TXN induces the FOS/JUN AP-1 DNA-binding activity in ionizing radiation (IR) cells through its oxidation/reduction status and stimulates AP-1 transcriptional activity. Specification Tested Reactivity: Human Cited Reactivity: human Host / Isotype: Mouse / IgG2a Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag6355 Product name: Recombinant human TXN protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-105 aa of BC003377 Sequence: MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVDDCQDVASECEVKCMPTFQFFKKGQKVGEFSGANKEKLEATINELV Predict reactive species Full Name: thioredoxin Calculated Molecular Weight: 12 kDa Observed Molecular Weight: 12 kDa GenBank Accession Number: BC003377 Gene Symbol: TXN Gene ID (NCBI): 7295 RRID: AB_2881841 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P10599 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924