Iright
BRAND / VENDOR: Proteintech

Proteintech, 66480-1-Ig, RhoGDI Monoclonal antibody

CATALOG NUMBER: 66480-1-Ig
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The RhoGDI (66480-1-Ig) by Proteintech is a Monoclonal antibody targeting RhoGDI in WB, ELISA applications with reactivity to Human, Mouse, Rat samples 66480-1-Ig targets RhoGDI in WB, ELISA applications and shows reactivity with Human, Mouse, Rat samples. Tested Applications Positive WB detected in: HeLa cells, C6 cells, HEK-293 cells, Jurkat cells, RAW 264.7 cells, NIH/3T3 cells Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Background Information Rho GDP-dissociation inhibitor (RhoGDI), also called ARHGDIA, is one member of ARHGDIs, which is ubiquitously expressed and interacts with several Rho GTPases, mainly including RhoA, Rac1, and Cdc42. RhoGDI can inhibit nucleotide exchange and membrane association to downregulate the activities of Rho family GTPase. It is overexpressed in various human cancers. Activity of this protein is important in a variety of cellular processes, and it is overexpressed in various human cancers. Mutations in RhoGDI have been found in individuals with nephrotic syndrome, type 8. Specification Tested Reactivity: Human, Mouse, Rat Host / Isotype: Mouse / IgG2a Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag0791 Product name: Recombinant human ARHGDIA,aGDI protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-204 aa of BC005851 Sequence: MAEQEPTAEQLAQIAAENEEDEHSVNYKPPAQKSIQEIQELDKDDESLRKYKEALLGRVAVSADPNVPNVVVTGLTLVCSSAPGPLELDLTGDLESFKKQSFVLKEGVEYRIKISFRVNREIVSGMKYIQHTYRKGVKIDKTDYMVGSYGPRAEEYEFLTPVEEAPKGMLARGSYSIKSRFTDDDKTDHLSWEWNLTIKKDWKD Predict reactive species Full Name: Rho GDP dissociation inhibitor (GDI) alpha Calculated Molecular Weight: 28 kDa Observed Molecular Weight: 28 kDa GenBank Accession Number: BC005851 Gene Symbol: RhoGDI Gene ID (NCBI): 396 RRID: AB_2881846 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P52565 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924