Proteintech, 66481-1-Ig, B7-H3/CD276 Monoclonal antibody

Size: 20ul / 150ul The B7-H3/CD276 (66481-1-Ig) by Proteintech is a Monoclonal antibody targeting B7-H3/CD276 in WB, IHC, IF-P, ELISA applications with reactivity to human, pig samples 66481-1-Ig targets B7-H3/CD276 in WB, IHC, IF-P, IP, CoIP, ELISA applications and shows reactivity with human, pig samples. Tested Applications Positive WB detected in: HEK-293 cells, A431 cells, PC-3 cells Positive IHC detected in: human tonsillitis tissue, human placenta tissue, human prostate cancer tissue, human lung cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: human placenta tissue Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Immunohistochemistry (IHC): IHC : 1:2500-1:10000 Immunofluorescence (IF)-P: IF-P : 1:200-1:800 Background Information B7-H3 (CD276) is a type I transmembrane protein expressed on many tissues and cell types. B7-H3 is a 100-kDa glycoprotein that belongs to the B7 immunoregulatory family and participates in the regulation of T-cell-mediated immune response probably by functioning as both a T cell costimulator and coinhibitor (PMID: 25567370; 20696859). Overexpressed on a wide range of human solid cancers, B7-H3 has been implicated in cancer progression and metastasis and becomes an attractive target for cancer immunotherapy (PMID: 27208063). Specification Tested Reactivity: human, pig Cited Reactivity: human Host / Isotype: Mouse / IgG2a Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag6006 Product name: Recombinant human CD276 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 41-181 aa of BC062581 Sequence: LVGTDATLCCSFSPEPGFSLAQLNLIWQLTDTKQLVHSFAEGQDQGSAYANRTALFPDLLAQGNASLRLQRVRVADEGSFTCFVSIRDFGSAAVSLQVAAPYSKPSMTLEPNKDLRPGDTVTITCSSYQGYPEAEVFWQDG Predict reactive species Full Name: CD276 molecule Calculated Molecular Weight: 57 kDa Observed Molecular Weight: 100 kDa GenBank Accession Number: BC062581 Gene Symbol: CD276 Gene ID (NCBI): 80381 RRID: AB_2881847 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q5ZPR3 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.