Iright
BRAND / VENDOR: Proteintech

Proteintech, 66514-1-Ig, USP7 Monoclonal antibody

CATALOG NUMBER: 66514-1-Ig
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The USP7 (66514-1-Ig) by Proteintech is a Monoclonal antibody targeting USP7 in WB, IHC, IF/ICC, ELISA applications with reactivity to Human, rat, mouse samples 66514-1-Ig targets USP7 in WB, IHC, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with Human, rat, mouse samples. Tested Applications Positive WB detected in: HeLa cells, A549 cells, LNCaP cells, HEK-293 cells, Jurkat cells, HSC-T6 cells, ROS1728 cells, NIH/3T3 cells, HepG2 cells, K-562 cells, 4T1 cells Positive IHC detected in: human prostate cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:5000-1:20000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Specification Tested Reactivity: Human, rat, mouse Cited Reactivity: human, mouse, rat Host / Isotype: Mouse / IgG2a Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag25652 Product name: Recombinant human USP7 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-93 aa of Sequence: MLLDNVENKMKGTCVEGTIPKLFRGKMVSYIQCKEVDYRSDRREDYYDIQLSIKGKKNIFESFVDYVAVEQLDGDNKYDAGEHGLQEAEKGVK Predict reactive species Full Name: ubiquitin specific peptidase 7 (herpes virus-associated) Observed Molecular Weight: 128 kDa Gene Symbol: USP7 Gene ID (NCBI): 7874 RRID: AB_2881877 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q93009 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924