Proteintech, 66521-1-Ig, Recoverin Monoclonal antibody

Size: 20ul / 150ul The Recoverin (66521-1-Ig) by Proteintech is a Monoclonal antibody targeting Recoverin in WB, ELISA applications with reactivity to Human, rat, pig, mouse samples 66521-1-Ig targets Recoverin in WB, ELISA applications and shows reactivity with Human, rat, pig, mouse samples. Tested Applications Positive WB detected in: pig retina tissue, rat retina tissue Recommended dilution Western Blot (WB): WB : 1:2500-1:10000 Background Information Recoverin, belonging to a family of the neuronal calcium sensor (NCS) proteins, has a restricted expression in retinal photoreceptors or neurons or neuroendocrine cells. It has been suggested to play a role in light and dark adaptation by regulating rhodopsin phosphorylation. Recently, it has been found that autoantibodies against recoverin (24 kDa) have been strongly associated with cancer -associated retinopathy (CAR) syndrome, a paraneoplastic disease of the retina. But functions of recoverin in cancer cells remain unknown. Specification Tested Reactivity: Human, rat, pig, mouse Cited Reactivity: human Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag0119 Product name: Recombinant human Recoverin protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 7-166 aa of BC001720 Sequence: GALSKEILEELQLNTKFSEEELCSWYQSFLKDCPTGRITQQQFQSIYAKFFPDTDPKAYAQHVFRSFDSNLDGTLDFKEYVIALHMTTAGKTNQKLEWAFSLYDVDGNGTISKNEVLEIVMAIFKMITPEDVKLLPDDENTPEKRAEKIWKYFGKNDDDK Predict reactive species Full Name: recoverin Calculated Molecular Weight: 24 kDa Observed Molecular Weight: 23 kDa GenBank Accession Number: BC001720 Gene Symbol: Recoverin Gene ID (NCBI): 5957 RRID: AB_2881884 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: P35243 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.