Iright
BRAND / VENDOR: Proteintech

Proteintech, 66522-1-Ig, SIAE Monoclonal antibody

CATALOG NUMBER: 66522-1-Ig
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The SIAE (66522-1-Ig) by Proteintech is a Monoclonal antibody targeting SIAE in WB, IF/ICC, ELISA applications with reactivity to human, mouse, rat, pig samples 66522-1-Ig targets SIAE in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat, pig samples. Tested Applications Positive WB detected in: pig liver tissue, pig colon tissue, rat colon tissue, mouse liver tissue Positive IF/ICC detected in: PC-3 cells Recommended dilution Western Blot (WB): WB : 1:2500-1:10000 Immunofluorescence (IF)/ICC: IF/ICC : 1:500-1:2000 Specification Tested Reactivity: human, mouse, rat, pig Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag14624 Product name: Recombinant human SIAE protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-350 aa of BC068450 Sequence: MVAPGLVLGLVLPLILWADRSAGIGFRFASYINNDMVLQKEPAGAVIWGFGTPGATVTVTLRQGQETIMKKVTSVKAHSDTWMVVLDPMKPGGPFEVMAQQTLEKINFTLRVHDVLFGDVWLCSGQSNMQMTVLQIFNATRELSNTAAYQSVRILSVSPIQAEQELEDLVAVDLQWSKPTSENLGHGYFKYMSAVCWLFGRHLYDTLQYPIGLIASSWGGTPIEAWSSGRSLKACGVPKQGSIPYDSVTGPSKHSVLWNAMIHPLCNMTLKGVVWYQGESNINYNTDLYNCTFPALIEDWRETFHRGSQGQTERFFPFGLVQLSSDLSKKSSDDGFPQIRWHQTADFGYV Predict reactive species Full Name: sialic acid acetylesterase Calculated Molecular Weight: 58 kDa Observed Molecular Weight: 70 kDa GenBank Accession Number: BC068450 Gene Symbol: SIAE Gene ID (NCBI): 54414 RRID: AB_2881885 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: Q9HAT2 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924