Proteintech, 66524-1-Ig, CGGBP1 Monoclonal antibody

Size: 20ul / 150ul The CGGBP1 (66524-1-Ig) by Proteintech is a Monoclonal antibody targeting CGGBP1 in WB, ELISA applications with reactivity to Human, Rat, mouse samples 66524-1-Ig targets CGGBP1 in WB, ELISA applications and shows reactivity with Human, Rat, mouse samples. Tested Applications Positive WB detected in: MCF-7 cells, NIH/3T3 cells, HEK-293 cells, Jurkat cells, K-562 cells, HSC-T6 cells Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Background Information CGGBP1, also named as CGGBP, is a 20 kDa CGG-binding protein. It binds to nonmethylated 5'-d(CGG)(n)-3' trinucleotide repeats in the FMR1 promoter. CGGBP1 may play a role in regulating FMR1 promoter. It is a bona fide midbody protein required for normal abscission and mitosis in general.(PMID:20832400) Specification Tested Reactivity: Human, Rat, mouse Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag1129 Product name: Recombinant human CGGBP1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-167 aa of BC005222 Sequence: MERFVVTAPPARNRSKTALYVTPLDRVTEFGGELHEDGGKLFCTSCNVVLNHVRKSAISDHLKSKTHTKRKAEFEEQNVRKKQRPLTASLQCNSTAQTEKVSVIQDFVKMCLEANIPLEKADHPAVRAFLSRHVKNGGSIPKSDQLRRTYLPDGYENENQLLNSQDC Predict reactive species Full Name: CGG triplet repeat binding protein 1 Calculated Molecular Weight: 19 kDa Observed Molecular Weight: 19 kDa GenBank Accession Number: BC005222 Gene Symbol: CGGBP1 Gene ID (NCBI): 8545 RRID: AB_2881887 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: Q9UFW8 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.