Proteintech, 66533-1-Ig, AP5Z1/SPG48 Monoclonal antibody

Size: 20ul / 150ul The AP5Z1/SPG48 (66533-1-Ig) by Proteintech is a Monoclonal antibody targeting AP5Z1/SPG48 in WB, IHC, IF/ICC, ELISA applications with reactivity to Human, rat samples 66533-1-Ig targets AP5Z1/SPG48 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with Human, rat samples. Tested Applications Positive WB detected in: Jurkat cells, HL-60 cells, Caco-2 cells, COLO 320 cells, HSC-T6 cells Positive IHC detected in: human liver cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HEK-293 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:5000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information AP5Z1, also known as SPG48 and KIAA0415, is a part of AP-5. Biallelic mutations in the AP5Z1 gene encoding the AP5Z1 subunit have been described in a small number of patients with hereditary spastic paraplegia (HSP). AP5Z1 physically interacts with other HSP proteins and that patient cells are sensitive to DNA damaging drugs. Specification Tested Reactivity: Human, rat Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag26961 Product name: Recombinant human KIAA0415 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 260-364 aa of BC037399 Sequence: TLDTDDRSEQEGSTLSVISATSSAGRLLPPRERLREVAFEYCQRLIEQSNRRALRKGDSDLQKACLVEAVLVLDVLCRQDPSFLYRSLSCLKALHGRVRGDPASV Predict reactive species Full Name: KIAA0415 Calculated Molecular Weight: 807 aa, 88 kDa Observed Molecular Weight: 88 kDa GenBank Accession Number: BC037399 Gene Symbol: AP5Z1/SPG48 Gene ID (NCBI): 9907 RRID: AB_2881896 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: O43299 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.