Proteintech, 66552-1-Ig, XLF Monoclonal antibody

Size: 20ul / 150ul The XLF (66552-1-Ig) by Proteintech is a Monoclonal antibody targeting XLF in WB, IHC, ELISA applications with reactivity to Human samples 66552-1-Ig targets XLF in WB, IHC, ELISA applications and shows reactivity with Human samples. Tested Applications Positive WB detected in: HeLa cells, HEK-293 cells, MCF-7 cells, Jurkat cells Positive IHC detected in: human testis tissue, human kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:5000-30000 Immunohistochemistry (IHC): IHC : 1:500-1:2000 Background Information XRCC4-like factor (XLF), also known as Cernunnos and NHEJ1, is a protein encoded by the human NHEJ1 gene and an important repair factor for DNA double-strand breaks. NHEJ is a well-known mechanism for the repair of double-strand breaks (DSBs), a lethal type of DNA damage in mammalian cells. It basically utilizes a group of enzymes to take hold of the ends of a broken DNA molecule, create a bridge between them, and subsequently re-ligate the broken DNA molecule. Specification Tested Reactivity: Human Host / Isotype: Mouse / IgG2b Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag2496 Product name: Recombinant human NHEJ1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-299 aa of BC030986 Sequence: MEELEQGLLMQPWAWLQLAENSLLAKVFITKQGYALLVSDLQQVWHEQVDTSVVSQRAKELNKRLTAPPAAFLCHLDNLLRPLLKDAAHPSEATFSCDCVADALILRVRSELSGLPFYWNFHCMLASPSLVSQHLIRPLMGMSLALQCQVRELATLLHMKDLEIQDYQESGATLIRDRLKTEPFEENSFLEQFMIEKLPEACSIGDGKPFVMNLQDLYMAVTTQEVQVGQKHQGAGDPHTSNSASLQGIDSQCVNQPEQLVSSAPTLSAPEKESTGTSGPLQRPQLSKVKRKKPRGLFS Predict reactive species Full Name: nonhomologous end-joining factor 1 Calculated Molecular Weight: 35 kDa Observed Molecular Weight: 37 kDa GenBank Accession Number: BC030986 Gene Symbol: XLF Gene ID (NCBI): 79840 RRID: AB_2881914 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q9H9Q4 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.