Iright
BRAND / VENDOR: Proteintech

Proteintech, 66553-1-Ig, Huntingtin Monoclonal antibody

CATALOG NUMBER: 66553-1-Ig
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The Huntingtin (66553-1-Ig) by Proteintech is a Monoclonal antibody targeting Huntingtin in IHC, IF/ICC, IF-P, ELISA applications with reactivity to human, mouse samples 66553-1-Ig targets Huntingtin in IHC, IF/ICC, IF-P, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive IHC detected in: human cerebellum tissue, human brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: rat cerebellum tissue Positive IF/ICC detected in: SH-SY5Y cells Recommended dilution Immunohistochemistry (IHC): IHC : 1:200-1:800 Immunofluorescence (IF)-P: IF-P : 1:200-1:800 Immunofluorescence (IF)/ICC: IF/ICC : 1:400-1:1600 Specification Tested Reactivity: human, mouse Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag25922 Product name: Recombinant human Huntingtin protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 2845-3000 aa of NM_002111 Sequence: LDVGPEFSASIIQMCGVMLSGSEESTPSIIYHCALRGLERLLLSEQLSRLDAESLVKLSVDRVNVHSPHRAMAALGLMLTCMYTGKEKVSPGRTSDPNPAAPDSESVIVAMERVSVLFDRIRKGFPCEARVVARILPQFLDDFFPPQDIMNKVIGE Predict reactive species Full Name: huntingtin Calculated Molecular Weight: 348 kDa GenBank Accession Number: NM_002111 Gene Symbol: Huntingtin Gene ID (NCBI): 3064 RRID: AB_2881915 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: P42858 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924