Iright
BRAND / VENDOR: Proteintech

Proteintech, 66560-1-Ig, HYAL1 Monoclonal antibody

CATALOG NUMBER: 66560-1-Ig
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The HYAL1 (66560-1-Ig) by Proteintech is a Monoclonal antibody targeting HYAL1 in WB, ELISA applications with reactivity to human samples 66560-1-Ig targets HYAL1 in WB, IF, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HepG2 cells, LNCaP cells, PC-3 cells, DU 145 cells, NCCIT cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Background Information Hyaluronic acid (HA) is a glycosaminoglycan that is believed to have numerous important biologic functions, including modulation of cell proliferation, migration, and differentiation, as well as the regulation of extracellular water and protein homeostasis. It is also an integral structural component of cartilage and other tissues and acts as a lubricant in joints. Hyaluronidases are a family of enzymes that catalyse the degradation of HA. In humans, there are five functional hyaluronidases: HYAL1, HYAL2, HYAL3, HYAL4 and HYAL5 (also known as SPAM1 or PH-20); plus a pseudogene, HYAL6 (also known as HYALP1). HYAL-1 is present in many tissues and is predominantly found in the plasma and urine (PMID: 16600643). In addition to its function in normal cellular hyaluronan turnover, human HYAL-1 is implicated in cancer proliferation, angiogenesis, and inflammatory diseases (PMID: 17503783). Specification Tested Reactivity: human Cited Reactivity: human, mouse Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag18183 Product name: Recombinant human HYAL1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 131-435 aa of BC035695 Sequence: EAWRPRWAFNWDTKDIYRQRSRALVQAQHPDWPAPQVEAVAQDQFQGAARAWMAGTLQLGRALRPRGLWGFYGFPDCYNYDFLSPNYTGQCPSGIRAQNDQLGWLWGQSRALYPSIYMPAVLEGTGKSQMYVQHRVAEAFRVAVAAGDPNLPVLPYVQIFYDTTNHFLPLDELEHSLGESAAQGAAGVVLWVSWENTRTKESCQAIKEYMDTTLGPFILNVTSGALLCSQALCSGHGRCVRRTSHPKALLLLNPASFSIQLTPGGGPLSLRGALSLEDQAQMAVEFKCRCYPGWQAPWCERKSMW Predict reactive species Full Name: hyaluronoglucosaminidase 1 Calculated Molecular Weight: 435 aa, 48 kDa Observed Molecular Weight: 60 kDa GenBank Accession Number: BC035695 Gene Symbol: HYAL1 Gene ID (NCBI): 3373 RRID: AB_2881921 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: Q12794 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924