Proteintech, 66562-1-Ig, TOM22 Monoclonal antibody

Size: 20ul / 150ul The TOM22 (66562-1-Ig) by Proteintech is a Monoclonal antibody targeting TOM22 in WB, IHC, IF/ICC, FC (Intra), ELISA applications with reactivity to human samples 66562-1-Ig targets TOM22 in WB, IHC, IF/ICC, FC (Intra), ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: A431 cells, T-47D cells, L02 cells, Raji cells, HeLa cells, HEK-293 cells, HepG2 cells, K-562 cells, Jurkat cells Positive IHC detected in: human kidney tissue, human colon cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HepG2 cells Positive FC (Intra) detected in: HEK-293 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension Background Information Tom22 is a central receptor component of the translocase of the outer membrane of mitochondria responsible for the recognition and translocation of cytosolically synthesized mitochondrial preproteins. It is showed in UniProt that phosphorylation is performed at three positions of this protein which may increase the molecular weight. Catalog#66562-1-Ig recognises  the  22 kDa  protein larger than the calculated MW which is 15 kDa. Besides, it has been reported the MV of TOMM22 is 22 kDa (PMID:19285029). Specification Tested Reactivity: human Cited Reactivity: human, mouse Host / Isotype: Mouse / IgG2a Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag1797 Product name: Recombinant human TOMM22 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-142 aa of BC009363 Sequence: MAAAVAAAGAGEPQSPDELLPKGDAEKPEEELEEDDDEELDETLSERLWGLTEMFPERVRSAAGATFDLSLFVAQKMYRFSRAALWIGTTSFMILVLPVVFETEKLQMEQQQQLQQRQILLGPNTGLSGGMPGALPSLPGKI Predict reactive species Full Name: translocase of outer mitochondrial membrane 22 homolog (yeast) Calculated Molecular Weight: 15 kDa Observed Molecular Weight: 22 kDa GenBank Accession Number: BC009363 Gene Symbol: TOMM22/Tom22 Gene ID (NCBI): 56993 RRID: AB_2881923 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q9NS69 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.