Iright
BRAND / VENDOR: Proteintech

Proteintech, 66569-1-Ig, LATS1 Monoclonal antibody

CATALOG NUMBER: 66569-1-Ig
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The LATS1 (66569-1-Ig) by Proteintech is a Monoclonal antibody targeting LATS1 in WB, ELISA applications with reactivity to human samples 66569-1-Ig targets LATS1 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: T-47D cells, HeLa cells, HEK-293 cells, HepG2 cells, MCF-7 cells, K-562 cells, Jurkat cells Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Background Information LATS1(Large tumor suppressor homolog 1) is also named as WARTS and belongds to the AGC Ser/Thr protein kinase family. The gene encodes a highly conserved (from fly to human) protein kinase that plays a crucial role in the prevention of tumor formation by controlling the progression of mitosis. The expression of both long(170 kDa) and short lats1 isoforms(120 kDa) in vertebrate retinal cells raises the possibility that these lats1 proteins may act as negative key regulators of the cell cycle each of them performing a unique role (PMID:15777619). In mammalian cells, LATS1 was phosphorylated in a cell cycle-dependent manner and complexed with CDC2 in early mitosis (PMID:9988268). LATS1 also can be detected as 120 kDa and 140-150 kDa, and play a key role in the regulation of Hippo pathway (PMID: 27940445). Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag11140 Product name: Recombinant human LATS1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-135 aa of BC015665 Sequence: MKRSEKPEGYRQMRPKTFPASNYTVSSRQMLQEIRESLRNLSKPSDAAKAEHNMSKMSTEDPRQVRNPPKFGTHHKALQEIRNSLLPFANETNSSRSTSEVNPQMLQDLQAAGFDEEDHLSVACSPISLTKPFLI Predict reactive species Full Name: LATS, large tumor suppressor, homolog 1 (Drosophila) Calculated Molecular Weight: 15 kDa, 127 kDa Observed Molecular Weight: 140-150 kDa, 120 kDa GenBank Accession Number: BC015665 Gene Symbol: LATS1 Gene ID (NCBI): 9113 RRID: AB_2881930 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: Q6PJG3 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924