Iright
BRAND / VENDOR: Proteintech

Proteintech, 66577-1-Ig, SLC9A9 Monoclonal antibody

CATALOG NUMBER: 66577-1-Ig
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The SLC9A9 (66577-1-Ig) by Proteintech is a Monoclonal antibody targeting SLC9A9 in WB, IHC, IF/ICC, ELISA applications with reactivity to Human, Mouse, Rat samples 66577-1-Ig targets SLC9A9 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with Human, Mouse, Rat samples. Tested Applications Positive WB detected in: HeLa cells, HEK-293 cells, MCF-7 cells, HepG2 cells, HSC-T6 cells, NIH/3T3 cells, RAW 264.7 cells Positive IHC detected in: human kidney tissue, human tonsillitis tissue, human liver cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Immunohistochemistry (IHC): IHC : 1:250-1:1000 Immunofluorescence (IF)/ICC: IF/ICC : 1:400-1:1600 Specification Tested Reactivity: Human, Mouse, Rat Cited Reactivity: human Host / Isotype: Mouse / IgG2a Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag4660 Product name: Recombinant human SLC9A9 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 481-645 aa of BC035779 Sequence: TPMLTWLQIRVGVDLDENLKEDPSSQHQEANNLDKNMTKAESARLFRMWYSFDHKYLKPILTHSGPPLTTTLPEWCGPISRLLTSPQAYGEQLKEDDVECIVNQDELAINYQEQASSPCSPPARLGLDQKASPQTPGKENIYEGDLGLGGYELKLEQTLGQSQLN Predict reactive species Full Name: solute carrier family 9 (sodium/hydrogen exchanger), member 9 Calculated Molecular Weight: 645 aa, 73 kDa Observed Molecular Weight: 73 kDa GenBank Accession Number: BC035779 Gene Symbol: SLC9A9 Gene ID (NCBI): 285195 RRID: AB_2881937 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q8IVB4 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924