Iright
BRAND / VENDOR: Proteintech

Proteintech, 66584-1-Ig, CHCHD5 Monoclonal antibody

CATALOG NUMBER: 66584-1-Ig
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The CHCHD5 (66584-1-Ig) by Proteintech is a Monoclonal antibody targeting CHCHD5 in WB, IHC, ELISA applications with reactivity to Human samples 66584-1-Ig targets CHCHD5 in WB, IHC, ELISA applications and shows reactivity with Human samples. Tested Applications Positive WB detected in: HEK-293 cells, HeLa cells, K-562 cells, THP-1 cells, HL-60 cells Positive IHC detected in: human ovary tumor tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Immunohistochemistry (IHC): IHC : 1:150-1:600 Specification Tested Reactivity: Human Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag22534 Product name: Recombinant human CHCHD5 protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 1-110 aa of BC004498 Sequence: MQAALEVTARYCGRELEQYGQCVAAKPESWQRDCHYLKMSIAQCTSSHPIIRQIRQACAQPFEAFEECLRQNEAAVGNCAEHMRRFLQCAEQVQPPRSPATVEAQPLPAS Predict reactive species Full Name: coiled-coil-helix-coiled-coil-helix domain containing 5 Calculated Molecular Weight: 110 aa, 12 kDa Observed Molecular Weight: 14 kDa GenBank Accession Number: BC004498 Gene Symbol: CHCHD5 Gene ID (NCBI): 84269 RRID: AB_2881944 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: Q9BSY4 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924