Iright
BRAND / VENDOR: Proteintech

Proteintech, 66590-1-Ig, c-Fos Monoclonal antibody

CATALOG NUMBER: 66590-1-Ig
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The c-Fos (66590-1-Ig) by Proteintech is a Monoclonal antibody targeting c-Fos in WB, FC (Intra), ELISA applications with reactivity to human, mouse, rat samples 66590-1-Ig targets c-Fos in WB, IHC, FC (Intra), IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HeLa cells, HepG2 cells, HSC-T6 cells, Jurkat cells, U-937 cells, RAW 264.7 cells, K-562 cells, THP-1 cells, NIH/3T3 cells Positive FC (Intra) detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.5 ug per 10^6 cells in a 100 µl suspension Background Information c-Fos, also named as FOS and G0/G1 switch regulatory protein 7, is a 380 amino acid protein, which contains 1 bZIP (basic-leucine zipper) domain and belongs to the bZIP family. c-Fos is expressed at very low levels in quiescent cells. When cells are stimulated to reenter growth, c-Fos undergo 2 waves of expression, the first one peaks 7.5 minutes following FBS induction. At this stage, the c-Fos protein is localized endoplasmic reticulum. The second wave of expression occurs at about 20 minutes after induction and peaks at 1 hour. At this stage, the c-FOS protein becomes nuclear. c-Fos is a very short-lived intracellular protein, which is very easy to degrade. The calculated molecular weight of c-Fos is 40 kDa, but Phosphorylated c-Fos protein is about 60-65 kDa. It is involved in important cellular events, including cell proliferation, differentiation and survival; genes associated with hypoxia; and angiogenesis; which makes its dysregulation an important factor for cancer development. It can also induce a loss of cell polarity and epithelial-mesenchymal transition, leading to invasive and metastatic growth in mammary epithelial cells. Expression of c-Fos is an indirect marker of neuronal activity because c-Fos is often expressed when neurons fire action potentials. Upregulation of c-Fos mRNA in a neuron indicates recent activity. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat, rabbit Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag24340 Product name: Recombinant human FOS protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 196-341 aa of BC004490 Sequence: ILAAHRPACKIPDDLGFPEEMSVASLDLTGGLPEVATPESEEAFTLPLLNDPEPKPSVEPVKSISSMELKTEPFDDFLFPASSRPSGSETARSVPDMDLSGSFYAADWEPLHSGSLGMGPMATELEPLCTPVVTCTPSCTAYTSSF Predict reactive species Full Name: FOS Calculated Molecular Weight: 41 kDa Observed Molecular Weight: 55-60 kDa GenBank Accession Number: BC004490 Gene Symbol: c-Fos Gene ID (NCBI): 2353 RRID: AB_2881950 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: P01100 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924