Proteintech, 66592-1-Ig, RAF1 Monoclonal antibody

Size: 20ul / 150ul The RAF1 (66592-1-Ig) by Proteintech is a Monoclonal antibody targeting RAF1 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse samples 66592-1-Ig targets RAF1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: HepG2 cells, DC2.4 cells, HEK-293 cells Positive IHC detected in: human prostate cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HEK-293 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Immunohistochemistry (IHC): IHC : 1:150-1:600 Immunofluorescence (IF)/ICC: IF/ICC : 1:400-1:1600 Background Information Raf-1 proto-oncogene, serine/threonine kinase(RAF1), is a MAP kinase kinase kinase (MAP3K), which functions downstream of the Ras family of membrane associated GTPases to which it binds directly. RAF1 has two isoforms with MW of 73, 75 kDa. RAF1 plays an important role in the control of gene expression involved in the cell division cycle, apoptosis, cell differentiation and cell migration. Specification Tested Reactivity: human, mouse Cited Reactivity: human, mouse Host / Isotype: Mouse / IgG2a Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag25423 Product name: Recombinant human RAF1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-59 aa of BC018119 Sequence: MEHIQGAWKTISNGFGFKDAVFDGSSCISPTIVQQFGYQRRASDDGKLTDPSKTSNTIR Predict reactive species Full Name: v-raf-1 murine leukemia viral oncogene homolog 1 Calculated Molecular Weight: 648 aa, 73 kDa Observed Molecular Weight: 70-75 kDa GenBank Accession Number: BC018119 Gene Symbol: RAF1 Gene ID (NCBI): 5894 RRID: AB_2881952 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P04049 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.