Proteintech, 66616-1-Ig, S100B Monoclonal antibody

Size: 20ul / 150ul The S100B (66616-1-Ig) by Proteintech is a Monoclonal antibody targeting S100B in WB, IHC, IF-P, ELISA applications with reactivity to human, rat samples 66616-1-Ig targets S100B in WB, IHC, IF-P, ELISA applications and shows reactivity with human, rat samples. Tested Applications Positive WB detected in: rabbit brain tissue, rat brain tissue, rat cerebellum tissue, rat spinal cord tissue Positive IHC detected in: rat brain tissue, human appendicitis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: rat brain tissue Recommended dilution Western Blot (WB): WB : 1:1000-1:2000 Immunohistochemistry (IHC): IHC : 1:1000-1:8000 Immunofluorescence (IF)-P: IF-P : 1:200-1:800 Background Information S100B is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs and has been implicated in the regulation of cellular activities such as metabolism, motility and proliferation. In the nervous system, S100B is constitutively released by astrocytes into the extracellular space and at nanomolar concentrations, it can promote neurite outgrowth and protect neurons against oxidative stress. Within the central nervous system (CNS), S100B is thought to be a marker for astroglial activation, linking astrocyte dysfunction to schizophrenia. In addition to astrocytes, S100B is released from many cell types, such as, adipocytes, chondrocytes, cardiomyocytes and lymphocytes. Serum S100B represents a new biomarker for mood disorders. Specification Tested Reactivity: human, rat Cited Reactivity: human, rat Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag7440 Product name: Recombinant human S100B protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-92 aa of BC001766 Sequence: MSELEKAMVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDNDGDGECDFQEFMAFVAMVTTACHEFFEHE Predict reactive species Full Name: S100 calcium binding protein B Calculated Molecular Weight: 11 kDa Observed Molecular Weight: 11 kDa GenBank Accession Number: BC001766 Gene Symbol: S100 Beta Gene ID (NCBI): 6285 RRID: AB_2881976 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: P04271 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.