Iright
BRAND / VENDOR: Proteintech

Proteintech, 66620-1-Ig, ADAM10 Monoclonal antibody

CATALOG NUMBER: 66620-1-Ig
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The ADAM10 (66620-1-Ig) by Proteintech is a Monoclonal antibody targeting ADAM10 in WB, IHC, ELISA applications with reactivity to human samples 66620-1-Ig targets ADAM10 in WB, IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: THP-1 cells, MCF-7 cells, Jurkat cells, K-562 cells Positive IHC detected in: human prostate cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Immunohistochemistry (IHC): IHC : 1:1000-1:4000 Background Information ADAM10, a member of the ADAM (a disintegrin and metalloprotease) family, is widely expressed in the brain, the spinal cord, and the visual system during development.MW of premature ADAM10 is 90 kDa and mature ADAM10 is 60-70 kDa (PMID: 24404179). Specification Tested Reactivity: human Cited Reactivity: human, mouse Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag23062 Product name: Recombinant human ADAM10 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 306-512 aa of BC126253 Sequence: EQNHDDYCLAYVFTDRDFDDGVLGLAWVGAPSGSSGGICEKSKLYSDGKKKSLNTGIITVQNYGSHVPPKVSHITFAHEVGHNFGSPHDSGTECTPGESKNLGQKENGNYIMYARATSGDKLNNNKFSLCSIRNISQVLEKKRNNCFVESGQPICGNGMVEQGEECDCGYSDQCKDECCFDANQPEGRKCKLKPGKQCSTVCIQVKV Predict reactive species Full Name: ADAM metallopeptidase domain 10 Calculated Molecular Weight: 748 aa, 84 kDa Observed Molecular Weight: 90-95 kDa GenBank Accession Number: BC126253 Gene Symbol: ADAM10 Gene ID (NCBI): 102 RRID: AB_2881980 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: O14672 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924