Proteintech, 66623-1-Ig, CHST4 Monoclonal antibody

Size: 20ul / 150ul The CHST4 (66623-1-Ig) by Proteintech is a Monoclonal antibody targeting CHST4 in WB, IHC, IF/ICC, ELISA applications with reactivity to human samples 66623-1-Ig targets CHST4 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HT-29 cells, T-47D cells, MCF-7 cells, COLO 320 cells Positive IHC detected in: human lung cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:400-1:1600 Background Information CHST4, also named as HEC GlcNAc6ST and GlcNAc6ST 2, is one of a major GlcNAc-6-O-sulfotransferases involved in synthesizing the L-selectin ligands mediating lymphocyte homing. CHST4 is associated with the expression of MECA-79 epitope on HEV. It has been reported that the transcripts of CHST4 can be detected in lymph node, liver, pancreas and high endothelial venules (HEVs) but at a low level in HUVECs. Besides, CHST4 is expressed at a high level in gastric and colorectal cancer patients compared with normal mucosa. (PMID:30093410, 27748735, 10330415) Specification Tested Reactivity: human Cited Reactivity: human, mouse Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag3987 Product name: Recombinant human CHST4 protein Source: e coli. -derived, T-HIS Tag: 6*His Domain: 177-386 aa of BC035282 Sequence: DPSLNLHIVHLVRDPRAVFRSRERTKGDLMIDSRIVMGQHEQKLKKEDQPYYVMQVICQSQLEIYKTIQSLPKALQERYLLVRYEDLARAPVAQTSRMYEFVGLEFLPHLQTWVHNITRGKGMGDHAFHTNARDALNVSQAWRWSLPYEKVSRLQKACGDAMNLLGYRHVRSEQEQRNLLLDLLSTWTVPEQIH Predict reactive species Full Name: carbohydrate (N-acetylglucosamine 6-O) sulfotransferase 4 Calculated Molecular Weight: 370 aa, 43 kDa Observed Molecular Weight: 48 kDa GenBank Accession Number: BC035282 Gene Symbol: CHST4 Gene ID (NCBI): 10164 RRID: AB_2881983 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: Q8NCG5 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.