Proteintech, 66633-1-Ig, ROCK2(middle) Monoclonal antibody

Size: 20ul / 150ul The ROCK2(middle) (66633-1-Ig) by Proteintech is a Monoclonal antibody targeting ROCK2(middle) in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 66633-1-Ig targets ROCK2(middle) in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HeLa cells, HEK-293 cells, MCF-7 cells, Jurkat cells, HSC-T6 cells, NIH/3T3 cells Positive IHC detected in: human liver cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:250-1:1000 Background Information ROCK2 is a serine/threonine kinase that regulates cytokinesis, smooth muscle contraction, the formation of actin stress fibers and focal adhesions, and the activation of the c-fos serum response element. It is an isozyme of ROCK1, is a target for the small GTPase Rho. ROCK2 is localized in both cytoplasm and nucleus, and the nucleus-localized ROCK2 can target p300 for phosphorylation to regulate its acetyltransferase activity (PMID:16574662).This antibody is specific to ROCK2. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat Host / Isotype: Mouse / IgG2b Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag16330 Product name: Recombinant human ROCK2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-180 aa of BC111801 Sequence: MEIDMTYQLKVIQQSLEQEEAEHKATKARLADKNKIYESIEEAKSEAMKEMEKKLLEERTLKQKVENLLLEAEKRCSLLDCDLKQSQQKINELLKQKDVLNEDVRNLTLKIEQETQKRCLTQNDLKMQTQQVNTLKMSEKQLKQENNHLMEMKMNLEKQNAELRKERQDADGQMKELQDQ Predict reactive species Full Name: Rho-associated, coiled-coil containing protein kinase 2 Calculated Molecular Weight: 77 kDa, 161 kDa Observed Molecular Weight: 161 kDa GenBank Accession Number: BC111801 Gene Symbol: ROCK2 Gene ID (NCBI): 9475 RRID: AB_2881992 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: O75116 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.