Proteintech, 66639-1-Ig, FANCL Monoclonal antibody

Size: 20ul / 150ul The FANCL (66639-1-Ig) by Proteintech is a Monoclonal antibody targeting FANCL in WB, IF/ICC, ELISA applications with reactivity to Human samples 66639-1-Ig targets FANCL in WB, IF/ICC, ELISA applications and shows reactivity with Human samples. Tested Applications Positive WB detected in: HeLa cells, HEK-293 cells Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:1000-1:3000 Immunofluorescence (IF)/ICC: IF/ICC : 1:400-1:1600 Background Information Fanconi anemia (FA) is a hereditary bone marrow failure syndrome associated with developmental defects and cancer predisposition. The FA nuclear core complex consists of FANCA, B, C, E, F, G, L, and M. FANCL is a RING-type E3 ubiquitin ligase that monoubiquitinates FANCD2 and FANCI, a key functional role facilitated by other members of the nuclear core complex (PMID: 23783032). FANCL plays an important role in the repair of cisplatin-induced DNA damage (PMID: 26385482) and participates directly in support of stem cell function (PMID: 23783032). FANCL can be detected as 40-43 kDa (full-length) and ~28 kDa. Specification Tested Reactivity: Human Cited Reactivity: human, mouse Host / Isotype: Mouse / IgG2a Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag6192 Product name: Recombinant human FANCL protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-375 aa of BC054517 Sequence: MAVTEASLLRQCPLLLPQNRSKTVYEGFISAQGRDFHLRIVLPEDLQLKNARLLCSWQLRTILSGYHRIVQQRMQHSPDLMSFMMELKMLLEVALKNRQELYALPPPPQFYSSLIEEIGTLGWDKLVYADTCFSTIKLKAEDASGREHLITLKLKAKYPAESPDYFVDFPVPFCASWTPQSSLISIYSQFLAAIESLKAFWDVMDEIDEKTWVLEPEKPPRSATARRIALGNNVSINIEVDPRHPTMLPECFFLGADHVVKPLGIKLSRNIHLWDPENSVLQNLKDVLEIDFPARAILEKSDFTMDCGICYAYQLDGTIPDQVCDNSQCGQPFHQICLYEWLRGLLTSRQSFNIIFGECPYCSKPITLKMSGRKH Predict reactive species Full Name: Fanconi anemia, complementation group L Calculated Molecular Weight: 43 kDa Observed Molecular Weight: 41-43 kDa GenBank Accession Number: BC054517 Gene Symbol: FANCL Gene ID (NCBI): 55120 RRID: AB_2881998 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q9NW38 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.