Proteintech, 66664-1-Ig, DDX54 Monoclonal antibody

Size: 20ul / 150ul The DDX54 (66664-1-Ig) by Proteintech is a Monoclonal antibody targeting DDX54 in WB, IF/ICC, FC (Intra), ELISA applications with reactivity to human, mouse samples 66664-1-Ig targets DDX54 in WB, IHC, IF/ICC, FC (Intra), ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: HepG2 cells, LNCaP cells, HeLa cells, Jurkat cells, K-562 cells, PC-3 cells, U-251 cells, U-87 MG cells Positive IF/ICC detected in: PC-3 cells Positive FC (Intra) detected in: PC-3 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension Background Information DDX54, also named as ATP-dependent RNA helicase DDX54, is a 881 amino acid protein, which contains 1 helicase ATP-binding domain and belongs to the DEAD box helicase family. DDX54/DBP10 subfamily. DDX54 localizes in nucleus and Interacts in a hormone-dependent manner with nuclear receptors. DDX54 has RNA-dependent ATPase activity and represses the transcriptional activity of nuclear receptors. Specification Tested Reactivity: human, mouse Cited Reactivity: human Host / Isotype: Mouse / IgG2a Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag25289 Product name: Recombinant human DDX54 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 778-881 aa of BC156669 Sequence: DDRDSDEEGASDRRGPERRGGKRDRGQGASRPHAPGTPAGRVRPELKTKQQILKQRRRAQKLHFLQRGGLKQLSARNRRRVQELQQGAFGRGARSKKGKMRKRM Predict reactive species Full Name: DEAD (Asp-Glu-Ala-Asp) box polypeptide 54 Calculated Molecular Weight: 98 kDa Observed Molecular Weight: 98 kDa GenBank Accession Number: BC156669 Gene Symbol: DDX54 Gene ID (NCBI): 79039 RRID: AB_2882019 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q8TDD1 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.