Iright
BRAND / VENDOR: Proteintech

Proteintech, 66667-1-Ig, EPHA7 Monoclonal antibody

CATALOG NUMBER: 66667-1-Ig
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The EPHA7 (66667-1-Ig) by Proteintech is a Monoclonal antibody targeting EPHA7 in WB, ELISA applications with reactivity to human, mouse, rat, pig samples 66667-1-Ig targets EPHA7 in WB, ELISA applications and shows reactivity with human, mouse, rat, pig samples. Tested Applications Positive WB detected in: human brain tissue, pig brain tissue, rat brain tissue, mouse cerebellum tissue Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Background Information Ephrin receptor A7 (EphA7) is a member of the Eph receptor family. EPHA7 plays a role in corticogenesis processes, determines brain size and shape, and is involved in development of the central nervous system (PMID:34176129). In addition, EphA7 also has a dual role of tumor promoter and tumor suppressor. It can participate in cell proliferation, migration and apoptosis through various mechanisms, and afect tumor diferentiation, staging and prognosis. EphA7 may be a potential diagnostic marker and tumor treatment target (PMID:35112312). Specification Tested Reactivity: human, mouse, rat, pig Cited Reactivity: human, mouse Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag3813 Product name: Recombinant human EPHA7 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 29-279 aa of BC027940 Sequence: AAKEVLLLDSKAQQTELEWISSPPNGWEEISGLDENYTPIRTYQVCQVMEPNQNNWLRTNWISKGNAQRIFVELKFTLRDCNSLPGVLGTCKETFNLYYYETDYDTGRNVRENLYVKIDTIAADESFTQGDLGERKMKLNTEVREIGPLSKKGFYLAFQDVGACIALVSVKVYYKKCWSIIENLAIFPDTVTGSEFSSLVEVRGTCVSSAEEEAENAPRMHCSAEGEWLVPIGKCICKAGYQQKGDTCECK Predict reactive species Full Name: EPH receptor A7 Calculated Molecular Weight: 998 aa, 112 kDa Observed Molecular Weight: 120 kDa GenBank Accession Number: BC027940 Gene Symbol: EPHA7 Gene ID (NCBI): 2045 RRID: AB_2882021 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: Q15375 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924