Iright
BRAND / VENDOR: Proteintech

Proteintech, 66672-1-Ig, PLZF Monoclonal antibody

CATALOG NUMBER: 66672-1-Ig
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The PLZF (66672-1-Ig) by Proteintech is a Monoclonal antibody targeting PLZF in WB, ELISA applications with reactivity to human, rat samples 66672-1-Ig targets PLZF in WB, IF, ELISA applications and shows reactivity with human, rat samples. Tested Applications Positive WB detected in: Ramos cells, Raji cells, Daudi cells, HeLa cells, THP-1 cells, human testis tissue Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Background Information PLZF, also named as Zinc finger protein 145, is a 673 amino acid protein, which belongs to the krueppel C2H2-type zinc-finger protein family. PLZF is expressed in bone marrow, early myeloid cell lines and peripheral blood mononuclear cells. PLZF may play a role in myeloid maturation and in the development and/or maintenance of other differentiated tissues. Specification Tested Reactivity: human, rat Cited Reactivity: mouse Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag25180 Product name: Recombinant human PLZF protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 101-400 aa of BC026902 Sequence: DLLYAAEILEIEYLEEQCLKMLETIQASDDNDTEATMADGGAEEEEDRKARYLKNIFISKHSSEESGYASVAGQSLPGPMVDQSPSVSTSFGLSAMSPTKAAVDSLMTIGQSLLQGTLQPPAGPEEPTLAGGGRHPGVAEVKTEMMQVDEVPSQDSPGAAESSISGGMGDKVEERGKEGPGTPTRSSVITSARELHYGREESAEQVPPPAEAGQAPTGRPEHPAPPPEKHLGIYSVLPNHKADAVLSMPSSVTSGLHVQPALAVSMDFSTYGGLLPQGFIQRELFSKLGELAVGMKSESR Predict reactive species Full Name: zinc finger and BTB domain containing 16 Calculated Molecular Weight: 673 aa, 74 kDa Observed Molecular Weight: 75 kDa GenBank Accession Number: BC026902 Gene Symbol: PLZF Gene ID (NCBI): 7704 RRID: AB_2882026 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: Q05516 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924