Proteintech, 66707-1-Ig, TDG Monoclonal antibody

Size: 20ul / 150ul The TDG (66707-1-Ig) by Proteintech is a Monoclonal antibody targeting TDG in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 66707-1-Ig targets TDG in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HeLa cells, HEK-293 cells, HT-29 cells, COLO 320 cells, Jurkat cells, Raji cells, HSC-T6 cells Positive IHC detected in: human breast cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:8000 Immunohistochemistry (IHC): IHC : 1:200-1:800 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information TDG belongs to the TDG/mug DNA glycosylase family. TDG corrects G/T mispairs to G/C pairs. It is capable of hydrolyzing the carbon-nitrogen bond between the sugar-phosphate backbone of the DNA and a mispaired thymine. In addition to the G/T, it can remove thymine also from C/T and T/T mispairs in the order G/T >> C/T > T/T. It has no detectable activity on apyrimidinic sites and does not catalyze the removal of thymine from A/T pairs or from single-stranded DNA. It can also remove uracil and 5-bromouracil from mispairs with guanine. RNF4 interacts with and requires the base excision repair enzymes TDG and APE1 for active demethylation (PMID:20696907). TDG is modified by SUMO-1 and SUMO-2/3.The molecular weight of non-modified TDG is 46 kDa and modified TDG is 55-60 kDa. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Mouse / IgG2b Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag27408 Product name: Recombinant human TDG protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-410 aa of BC037557 Sequence: MEAENAGSYSLQQAQAFYTFPFQQLMAEAPNMAVVNEQQMPEEVPAPAPAQEPVQEAPKGRKRKPRTTEPKQPVEPKKPVESKKSGKSAKSKEKQEKITDTFKVKRKVDRFNGVSEAELLTKTLPDILTFNLDIVIIGINPGLMAAYKGHHYPGPGNHFWKCLFMSGLSEVQLNHMDDHTLPGKYGIGFTNMVERTTPGSKDLSSKEFREGGRILVQKLQKYQPRIAVFNGKCIYEIFSKEVFGVKVKNLEFGLQPHKIPDTETLCYGMPSSSARCAQFPRAQDKVHYYIKLKDLRDQLKGIERNMDVQEVQYTFDLQLAQEDAKKMAVKEEKYDPGYEAAYGGAYGENPCSSEPCGFSSNGLIESVELRGESAFSGIPNGQWMTQSFTDQIPSFSNHCGTQEQEEESHA Predict reactive species Full Name: thymine-DNA glycosylase Calculated Molecular Weight: 410 aa, 46 kDa Observed Molecular Weight: 55-60 kDa GenBank Accession Number: BC037557 Gene Symbol: TDG Gene ID (NCBI): 6996 RRID: AB_2882059 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: Q13569 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.