Iright
BRAND / VENDOR: Proteintech

Proteintech, 66715-1-Ig, GSTP1 Monoclonal antibody

CATALOG NUMBER: 66715-1-Ig
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The GSTP1 (66715-1-Ig) by Proteintech is a Monoclonal antibody targeting GSTP1 in WB, IHC, IF/ICC, IP, ELISA applications with reactivity to human, rat samples 66715-1-Ig targets GSTP1 in WB, IHC, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with human, rat samples. Tested Applications Positive WB detected in: HuH-7 cells, HeLa cells, HEK-293 cells, HepG2 cells, Jurkat cells, HCT 116 cells, Caco-2 cells, SCaBER cells, MCF-10A cells Positive IP detected in: HeLa cells Positive IHC detected in: human colon cancer tissue, human cervical cancer tissue, human kidney tissue, human ovary tumor tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:500-1:2000 Immunofluorescence (IF)/ICC: IF/ICC : 1:400-1:1600 Specification Tested Reactivity: human, rat Cited Reactivity: human, mouse, rat Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag8880 Product name: Recombinant human GSTP1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-210 aa of BC010915 Sequence: MPPYTVVYFPVRGRCAALRMLLADQGQSWKEEVVTVETWQEGSLKASCLYGQLPKFQDGDLTLYQSNTILRHLGRTLGLYGKDQQEAALVDMVNDGVEDLRCKYVSLIYTNYEAGKDDYVKALPGQLKPFETLLSQNQGGKTFIVGDQISFADYNLLDLLLIHEVLAPGCLDAFPLLSAYVGRLSARPKLKAFLASPEYVNLPINGNGKQ Predict reactive species Full Name: glutathione S-transferase pi 1 Calculated Molecular Weight: 210 aa, 23 kDa Observed Molecular Weight: 23 kDa GenBank Accession Number: BC010915 Gene Symbol: GSTP1 Gene ID (NCBI): 2950 RRID: AB_2882066 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: P09211 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924