Proteintech, 66716-1-Ig, RBX1 Monoclonal antibody

Size: 20ul / 150ul The RBX1 (66716-1-Ig) by Proteintech is a Monoclonal antibody targeting RBX1 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 66716-1-Ig targets RBX1 in WB, IHC, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HeLa cells, RAW 264.7 cells, HEK-293 cells, HepG2 cells, Jurkat cells Positive IHC detected in: human liver cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: A431 cells Recommended dilution Western Blot (WB): WB : 1:20000-1:50000 Immunohistochemistry (IHC): IHC : 1:2500-1:10000 Immunofluorescence (IF)/ICC: IF/ICC : 1:1000-1:4000 Background Information RBX1(RING-box protein 1) is also named as RNF75, ROC1 and is a requisite component of the multi- subunit SCF family E3s36-40. It mediates the ubiquitination and subsequent proteasomal degradation of target proteins, including proteins involved in cell cycle progression, signal transduction, transcription and transcription-coupled nucleotide excision repair. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag7005 Product name: Recombinant human RBX1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-108 aa of BC001466 Sequence: MAAAMDVDTPSGTNSGAGKKRFEVKKWNAVALWAWDIVVDNCAICRNHIMDLCIECQANQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNREWEFQKYGH Predict reactive species Full Name: ring-box 1 Calculated Molecular Weight: 12 kDa Observed Molecular Weight: 12-15 kDa GenBank Accession Number: BC001466 Gene Symbol: RBX1 Gene ID (NCBI): 9978 RRID: AB_2882067 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: P62877 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.