Iright
BRAND / VENDOR: Proteintech

Proteintech, 66731-1-Ig, HIF2α/EPAS1 Monoclonal antibody

CATALOG NUMBER: 66731-1-Ig
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The HIF2α/EPAS1 (66731-1-Ig) by Proteintech is a Monoclonal antibody targeting HIF2α/EPAS1 in WB, IHC, ELISA applications with reactivity to Human samples 66731-1-Ig targets HIF2α/EPAS1 in WB, IHC, IF, ELISA applications and shows reactivity with Human samples. Tested Applications Positive WB detected in: HeLa cells, HepG2 cells Positive IHC detected in: human colon cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:5000 Immunohistochemistry (IHC): IHC : 1:250-1:1000 Background Information Endothelial PAS domain-containing protein 1 (EPAS1), also known as Hypoxia-inducible factor 2-alpha (HIF2-alpha,HIF2A), is a transcription factor involved in the induction of oxygen regulated genes. Binds to core DNA sequence 5'-[AG]CGTG-3' within the hypoxia response element (HRE) of target gene promoters. Regulates the vascular endothelial growth factor (VEGF) expression and seems to be implicated in the development of blood vessels and the tubular system of lung. May also play a role in the formation of the endothelium that gives rise to the blood brain barrier. Potent activator of the Tie-2 tyrosine kinase expression. Activation seems to require recruitment of transcriptional coactivators such as CREBPB and probably EP300. Interaction with redox regulatory protein APEX seems to activate CTAD. EPAS1 is expressed in most tissues, with highest levels in placenta, lung and heart. Selectively expressed in endothelial cells. Specification Tested Reactivity: Human Cited Reactivity: human, bovine Host / Isotype: Mouse / IgG2a Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag24886 Product name: Recombinant human EPAS1 protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 521-870 aa of BC051338 Sequence: FNELDLETLAPYIPMDGEDFQLSPICPEERLLAENPQSTPQHCFSAMTNIFQPLAPVAPHSPFLLDKFQQQLESKKTEPEHRPMSSIFFDAGSKASLPPCCGQASTPLSSMGGRSNTQWPPDPPLHFGPTKWAVGDQRTEFLGAAPLGPPVSPPHVSTFKTRSAKGFGARGPDVLSPAMVALSNKLKLKRQLEYEEQAFQDLSGGDPPGGSTSHLMWKRMKNLRGGSCPLMPDKPLSANVPNDKFTQNPMRGLGHPLRHLPLPQPPSAISPGENSKSRFPPQCYATQYQDYSLSSAHKVSGMASRLLGPSFESYLLPELTRYDCEVNVPVLGSSTLLQGGDLLRALDQAT Predict reactive species Full Name: endothelial PAS domain protein 1 Calculated Molecular Weight: 96 kDa Observed Molecular Weight: 120 kDa GenBank Accession Number: BC051338 Gene Symbol: HIF2α Gene ID (NCBI): 2034 RRID: AB_2882081 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q99814 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924