Proteintech, 66741-1-Ig, CHOP/GADD153 Monoclonal antibody

Size: 20ul / 150ul The CHOP/GADD153 (66741-1-Ig) by Proteintech is a Monoclonal antibody targeting CHOP/GADD153 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 66741-1-Ig targets CHOP/GADD153 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HSC-T6 cells, HepG2 cells, C6 cells, NIH/3T3 cells, Tunicamycin treated HepG2 cells Positive IHC detected in: human cervical cancer tissue, human skin cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Immunohistochemistry (IHC): IHC : 1:250-1:1000 Background Information CHOP, also known as GADD153 or DDIT3, is a highly conserved gene in both the structural and regulatory regions. Imposed by unfolded and misfolded proteins, CHOP is significantly induced by ER stress. CHOP is considered a proapoptotic marker of ER stress dependent cell death. CHOP acts as a dominant-negative inhibitor of the transcription factor C/EBP and LAP. It may play an important role in the malignant transformation of nevus to melanoma. The calculated molecular weight of CHOP is 19 kDa, but the protein migrates on an SDS-PAGE gel with an observed molecular mass of 29 kDa (PMID: 1547942). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat, pig, rabbit, shrew Host / Isotype: Mouse / IgG2a Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag7354 Product name: Recombinant human CHOP; GADD153 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-169 aa of BC003637 Sequence: MAAESLPFSFGTLSSWELEAWYEDLQEVLSSDENGGTYVSPPGNEEEESKIFTTLDPASLAWLTEEEPEPAEVTSTSQSPHSPDSSQSSLAQEEEEEDQGRTRKRKQSGHSPARAGKQRMKEKEQENERKVAQLAEENERLKQEIERLTREVEATRRALIDRMVNLHQA Predict reactive species Full Name: DNA-damage-inducible transcript 3 Calculated Molecular Weight: 19 kDa Observed Molecular Weight: 30 kDa GenBank Accession Number: BC003637 Gene Symbol: CHOP Gene ID (NCBI): 1649 RRID: AB_2882089 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P35638 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.