Proteintech, 66745-1-Ig, YTHDF1 Monoclonal antibody

Size: 20ul / 150ul The YTHDF1 (66745-1-Ig) by Proteintech is a Monoclonal antibody targeting YTHDF1 in WB, IHC, IP, ELISA applications with reactivity to human, mouse, rat samples 66745-1-Ig targets YTHDF1 in WB, IHC, IF, IP, CoIP, RIP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HEK-293 cells, HepG2 cells, HeLa cells, Jurkat cells, K-562 cells, HSC-T6 cells, NIH/3T3 cellls Positive IP detected in: Jurkat cells Positive IHC detected in: human colon cancer tissue, human breast cancer tissue, mouse testis tissue, rat testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:1000-1:4000 Background Information YTHDF1, also named as YTH domain-containing family protein 1 or C20orf21, is a 559 amino acid protein, which localizes in the cytoplasm. YTHDF1 specifically recognizes and binds N6-methyladenosine (m6A)-containing mRNAs, and promotes mRNA translation efficiency. M6A is a modification present at internal sites of mRNAs and some non-coding RNAs and plays a role in the efficiency of mRNA splicing, processing and stability. YTHDF1 acts as a regulator of mRNA translation efficiency: promotes ribosome loading to m6A-containing mRNAs and interacts with translation initiation factors eIF3 (EIF3A or EIF3B) to facilitate translation initiation. YTHDF1 exists two isoform and calculated molecular weight of isoforms are 61 kDa and 21 kDa. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat, pig Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag11633 Product name: Recombinant human YTHDF1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 210-559 aa of BC050284 Sequence: VALTGVLSGNGGTNVNMPVSKPTSWAAIASKPAKPQPKMKTKSGPVMGGGLPPPPIKHNMDIGTWDNKGPVPKAPVPQQAPSPQAAPQPQQVAQPLPAQPPALAQPQYQSPQQPPQTRWVAPRNRNAAFGQSGGAGSDSNSPGNVQPNSAPSVESHPVLEKLKAAHSYNPKEFEWNLKSGRVFIIKSYSEDDIHRSIKYSIWCSTEHGNKRLDSAFRCMSSKGPVYLLFSVNGSGHFCGVAEMKSPVDYGTSAGVWSQDKWKGKFDVQWIFVKDVPNNQLRHIRLENNDNKPVTNSRDTQEVPLEKAKQVLKIISSYKHTTSIFDDFAHYEKRQEEEEVVRKERQSRNKQ Predict reactive species Full Name: YTH domain family, member 1 Calculated Molecular Weight: 559 aa, 61 kDa Observed Molecular Weight: 60 kDa GenBank Accession Number: BC050284 Gene Symbol: YTHDF1 Gene ID (NCBI): 54915 RRID: AB_2882093 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: Q9BYJ9 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.