Proteintech, 66764-1-Ig, CKB/CKM Monoclonal antibody

Size: 20ul / 150ul The CKB/CKM (66764-1-Ig) by Proteintech is a Monoclonal antibody targeting CKB/CKM in WB, IHC, ELISA applications with reactivity to human, mouse samples 66764-1-Ig targets CKB/CKM in WB, IHC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: HEK-293 cells, HeLa cells Positive IHC detected in: mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:10000-1:50000 Immunohistochemistry (IHC): IHC : 1:500-1:2000 Background Information CKBB, also named as B-CK and CKB, is a member of the ATP:guanido phosphotransferase protein family. It is a cytoplasmic enzyme involved in energy homeostasis. CKBB reversibly catalyzes the transfer of phosphate between ATP and various phosphogens such as creatine phosphate. It acts as a homodimer in brain as well as in other tissues, and as a heterodimer with a similar muscle isozyme in heart. CK isoenzymes play a central role in energy transduction in tissues with large, fluctuating energy demands, such as skeletal muscle, heart, brain and spermatozoa. CK MB consists of a dimer of nonidentical chains. With MM being the major form in skeletal muscle and myocardium, MB existing in myocardium, and BB existing in many tissues, especially brain. This antibody can recognize both CKB and CKM due to the high homology. Specification Tested Reactivity: human, mouse Cited Reactivity: human Host / Isotype: Mouse / IgG2a Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag7933 Product name: Recombinant human CKB protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-381 aa of BC001190 Sequence: MPFSNSHNALKLRFPAEDEFPDLSAHNNHMAKVLTPELYAELRAKSTPSGFTLDDVIQTGVDNPGHPYIMTVGCVAGDEESYEVFKDLFDPIIEDRHGGYKPSDEHKTDLNPDNLQGGDDLDPNYVLSSRVRTGRSIRGFCLPPHCSRGERRAIEKLAVEALSSLDGDLAGRYYALKSMTEAEQQQLIDDHFLFDKPVSPLLLASGMARDWPDARGIWHNDNKTFLVWVNEEDHLRVISMQKGGNMKEVFTRFCTGLTQIETLFKSKDYEFMWNPHLGYILTCPSNLGTGLRAGVHIKLPNLGKHEKFSEVLKRLRLQKRGTGGVDTAAVGGVFDVSNADRLGFSEVELVQMVVDGVKLLIEMEQRLEQGQAIDDLMPAQK Predict reactive species Full Name: creatine kinase, brain Calculated Molecular Weight: 43 kDa Observed Molecular Weight: 43 kDa GenBank Accession Number: BC001190 Gene Symbol: CKB Gene ID (NCBI): 1152 RRID: AB_2882110 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P12277 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.