Iright
BRAND / VENDOR: Proteintech

Proteintech, 66767-1-Ig, HSP27 Monoclonal antibody

CATALOG NUMBER: 66767-1-Ig
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The HSP27 (66767-1-Ig) by Proteintech is a Monoclonal antibody targeting HSP27 in WB, IHC, IF, FC (Intra), ELISA applications with reactivity to human, mouse, rat, zebrafish samples 66767-1-Ig targets HSP27 in WB, IHC, IF, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat, zebrafish samples. Tested Applications Positive WB detected in: HCT 116 cells, HeLa cells, HSC-T6 cells, mouse liver tissue, U2OS cells, A549 cells, HepG2 cells, HuH-7 cells Positive IHC detected in: human gliomas tissue, human liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF detected in: zebrafish retina, MCF-7 cells Positive FC (Intra) detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:20000-1:100000 Immunohistochemistry (IHC): IHC : 1:1000-1:4000 Immunofluorescence (IF): IF : 1:50-1:500 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.50 ug per 10^6 cells in a 100 µl suspension Background Information HSPB1, also known as heat shock protein 27 (Hsp27), belongs to the small heat shock protein family which is induced in response to environmental challenges or/and developmental transitions. It is also an anti-apoptotic protein that plays crucial roles in tumorigenesis and cell survival and is reported to be an independent prognosis marker for cancer. Recently HSPB1 has been found to be a valuable marker for melanoma. In addition to the predicted 27 kDa, an extra 50-55 kDa representing dimeric form of HSPB1 may also be observed (21353161). Specification Tested Reactivity: human, mouse, rat, zebrafish Cited Reactivity: human, mouse Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag27859 Product name: Recombinant human HSPB1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-205 aa of BC012768 Sequence: MTERRVPFSLLRGPSWDPFRDWYPHSRLFDQAFGLPRLPEEWSQWLGGSSWPGYVRPLPPAAIESPAVAAPAYSRALSRQLSSGVSEIRHTADRWRVSLDVNHFAPDELTVKTKDGVVEITGKHEERQDEHGYISRCFTRKYTLPPGVDPTQVSSSLSPEGTLTVEAPMPKLATQSNEITIPVTFESRAQLGGPEAAKSDETAAK Predict reactive species Full Name: heat shock 27kDa protein 1 Calculated Molecular Weight: 19-23 kDa Observed Molecular Weight: 27 kDa GenBank Accession Number: BC012768 Gene Symbol: HSPB1 Gene ID (NCBI): 3315 RRID: AB_2882113 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: P04792 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924