Iright
BRAND / VENDOR: Proteintech

Proteintech, 66768-1-Ig, AGR2 Monoclonal antibody

CATALOG NUMBER: 66768-1-Ig
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The AGR2 (66768-1-Ig) by Proteintech is a Monoclonal antibody targeting AGR2 in WB, IHC, IF/ICC, IF-P, FC (Intra), ELISA applications with reactivity to human, pig samples 66768-1-Ig targets AGR2 in WB, IHC, IF/ICC, IF-P, FC (Intra), ELISA applications and shows reactivity with human, pig samples. Tested Applications Positive WB detected in: pig stomach tissue, T-47D cells, HT-29 cells Positive IHC detected in: human breast cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: human colon cancer tissue Positive IF/ICC detected in: HT-29 cells, A549 cells Positive FC (Intra) detected in: HT-29 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Immunohistochemistry (IHC): IHC : 1:150-1:600 Immunofluorescence (IF)-P: IF-P : 1:200-1:800 Immunofluorescence (IF)/ICC: IF/ICC : 1:400-1:1600 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.20 ug per 10^6 cells in a 100 µl suspension Background Information AGR2, also named AG2 or HPC8, encodes anterior gradient protein 2 homolog which belongs to the AGR family. It is a secreted protein localized in endoplasmic reticulum. AGR2 plays roles in MUC2 post-transcriptional synthesis,secretion and production of mucus by intestinal cells. AGR2 was significantly elevated in the pancreatic juice from patients with pre-malignant conditions as well as pancreatic cancer compared to control pancreatic juice samples. AGR2 levels in pancreatic juice could potentially be used to aide in assessment of high-risk patients undergoing endoscopic procedures. Specification Tested Reactivity: human, pig Cited Reactivity: human Host / Isotype: Mouse / IgG2b Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag2919 Product name: Recombinant human AGR2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 17-175 aa of BC015503 Sequence: YTLARDTTVKPGAKKDTKDSRPKLPQTLSRGWGDQLIWTQTYEEALYKSKTSNKPLMIIHHLDECPHSQALKKVFAENKEIQKLAEQFVLLNLVYETTDKHLSPDGQYVPRIMFVDPSLTVRADITGRYSNRLYAYEPADTALLLDNMKKALKLLKTEL Predict reactive species Full Name: anterior gradient homolog 2 (Xenopus laevis) Calculated Molecular Weight: 175 aa, 20 kDa Observed Molecular Weight: 17 kDa GenBank Accession Number: BC015503 Gene Symbol: AGR2 Gene ID (NCBI): 10551 RRID: AB_2882114 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: O95994 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924