Iright
BRAND / VENDOR: Proteintech

Proteintech, 66772-1-Ig, SSTR5 Monoclonal antibody

CATALOG NUMBER: 66772-1-Ig
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The SSTR5 (66772-1-Ig) by Proteintech is a Monoclonal antibody targeting SSTR5 in WB, IF-P, ELISA applications with reactivity to Human, Mouse, Rat samples 66772-1-Ig targets SSTR5 in WB, IF-P, CoIP, ELISA applications and shows reactivity with Human, Mouse, Rat samples. Tested Applications Positive WB detected in: HSC-T6 cells, HeLa cells, HEK-293 cells, HepG2 cells, NIH/3T3 cells, Neuro-2a cells Positive IF-P detected in: mouse kidney tissue Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Immunofluorescence (IF)-P: IF-P : 1:200-1:800 Background Information Somatostatin is a widely distributed peptide with a broad range of biological actions. Two biological forms of somatostatin exist: somatostatin-14 and -28. Somatostatin receptors (SSTR1, 2A and B, 3, 4 and 5) belong to the G protein coupled receptor family and have a wide expression pattern in both normal tissues and solid tumors (PMID: 23872332). SSTR5 has greater affinity for somatostatin-28 than somatostatin-14 (PMID: 8373420). Specification Tested Reactivity: Human, Mouse, Rat Cited Reactivity: human, mouse, rat Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag18615 Product name: Recombinant human SSTR5 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 302-364 aa of BC146576 Sequence: VLYGFLSDNFRQSFQKVLCLRKGSGAKDADATEPRPDRIRQQQEATPPAHRAAANGLMQTSKL Predict reactive species Full Name: somatostatin receptor 5 Calculated Molecular Weight: 364 aa, 39 kDa Observed Molecular Weight: 41 kDa GenBank Accession Number: BC146576 Gene Symbol: SSTR5 Gene ID (NCBI): 6755 RRID: AB_2882118 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: P35346 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924