Product Description
Size: 20ul / 150ul
The SSTR5 (66772-1-Ig) by Proteintech is a Monoclonal antibody targeting SSTR5 in WB, IF-P, ELISA applications with reactivity to Human, Mouse, Rat samples
66772-1-Ig targets SSTR5 in WB, IF-P, CoIP, ELISA applications and shows reactivity with Human, Mouse, Rat samples.
Tested Applications
Positive WB detected in: HSC-T6 cells, HeLa cells, HEK-293 cells, HepG2 cells, NIH/3T3 cells, Neuro-2a cells
Positive IF-P detected in: mouse kidney tissue
Recommended dilution
Western Blot (WB): WB : 1:1000-1:6000
Immunofluorescence (IF)-P: IF-P : 1:200-1:800
Background Information
Somatostatin is a widely distributed peptide with a broad range of biological actions. Two biological forms of somatostatin exist: somatostatin-14 and -28. Somatostatin receptors (SSTR1, 2A and B, 3, 4 and 5) belong to the G protein coupled receptor family and have a wide expression pattern in both normal tissues and solid tumors (PMID: 23872332). SSTR5 has greater affinity for somatostatin-28 than somatostatin-14 (PMID: 8373420).
Specification
Tested Reactivity: Human, Mouse, Rat
Cited Reactivity: human, mouse, rat
Host / Isotype: Mouse / IgG1
Class: Monoclonal
Type: Antibody
Immunogen: CatNo: Ag18615 Product name: Recombinant human SSTR5 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 302-364 aa of BC146576 Sequence: VLYGFLSDNFRQSFQKVLCLRKGSGAKDADATEPRPDRIRQQQEATPPAHRAAANGLMQTSKL Predict reactive species
Full Name: somatostatin receptor 5
Calculated Molecular Weight: 364 aa, 39 kDa
Observed Molecular Weight: 41 kDa
GenBank Accession Number: BC146576
Gene Symbol: SSTR5
Gene ID (NCBI): 6755
RRID: AB_2882118
Conjugate: Unconjugated
Form: Liquid
Purification Method: Protein G purification
UNIPROT ID: P35346
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924