Proteintech, 66773-1-Ig, Apolipoprotein A II/APOA2 Monoclonal antibody

Size: 20ul / 150ul The Apolipoprotein A II/APOA2 (66773-1-Ig) by Proteintech is a Monoclonal antibody targeting Apolipoprotein A II/APOA2 in WB, IHC, ELISA applications with reactivity to human samples 66773-1-Ig targets Apolipoprotein A II/APOA2 in WB, IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: human plasma tissue Positive IHC detected in: human liver cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information Apolipoprotein A-II (APOA2) is a major component of high density lipoprotein (HDL) and it plays an important role in directing the fate of lipid metabolism among HDL. It is primarily synthesized by liver. The predicted MW of ApoA2 is 11 kDa, while the mature form is smaller (7-10 kDa) since the signal peptide was cleaved. In humans, most of circulating apoA2 exist as dimer. Five types of APOA2 dimer exist: homodimer apoA2-ATQ/ATQ, heterodimer apoA2-ATQ/AT, homodimer apoA2-AT/AT, apoA2-AT/A, and apoA2-A/A. ApoA2 isoforms are considered to be some of the most promising serum/plasma biomarkers for aiding the early detection of pancreatic cancer. (PMID: 29081441, 29481802) Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Mouse / IgG2b Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag9863 Product name: Recombinant human APOA2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-100 aa of BC005282 Sequence: MKLLAATVLLLTICSLEGALVRRQAKEPCVESLVSQYFQTVTDYGKDLMEKVKSPELQAEAKSYFEKSKEQLTPLIKKAGTELVNFLSYFVELGTQPATQ Predict reactive species Full Name: apolipoprotein A-II Calculated Molecular Weight: 100 aa, 11 kDa Observed Molecular Weight: 8-11 kDa GenBank Accession Number: BC005282 Gene Symbol: APOA2 Gene ID (NCBI): 336 RRID: AB_2882119 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P02652 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.