Iright
BRAND / VENDOR: Proteintech

Proteintech, 66774-1-Ig, KCNQ2 Monoclonal antibody

CATALOG NUMBER: 66774-1-Ig
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The KCNQ2 (66774-1-Ig) by Proteintech is a Monoclonal antibody targeting KCNQ2 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat, pig samples 66774-1-Ig targets KCNQ2 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat, pig samples. Tested Applications Positive WB detected in: pig brain tissue, rat brain tissue, mouse brain tissue Positive IHC detected in: mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: U2OS cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunohistochemistry (IHC): IHC : 1:300-1:1200 Immunofluorescence (IF)/ICC: IF/ICC : 1:400-1:1600 Specification Tested Reactivity: human, mouse, rat, pig Cited Reactivity: mouse, rat Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag25781 Product name: Recombinant human KCNQ2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-81 aa of BC000699 Sequence: MVQKSRNGGVYPGPSGEKKLKVGFVGLDPGAPDSTRDGALLIAGSEAPKRGSILSKPRAGGAGAGKPPKRNAFYRKLQNFL Predict reactive species Full Name: potassium voltage-gated channel, KQT-like subfamily, member 2 Calculated Molecular Weight: 96 kDa Observed Molecular Weight: 90 kDa GenBank Accession Number: BC000699 Gene Symbol: KCNQ2 Gene ID (NCBI): 3785 RRID: AB_2882120 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: O43526 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924