Proteintech, 66798-1-Ig, HPGD Monoclonal antibody

Size: 20ul / 150ul The HPGD (66798-1-Ig) by Proteintech is a Monoclonal antibody targeting HPGD in WB, IHC, IF/ICC, FC (Intra), ELISA applications with reactivity to human samples 66798-1-Ig targets HPGD in WB, IHC, IF/ICC, FC (Intra), ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: COLO 320 cells, human small intestine tissue, Caco-2 cells, HT-29 cells, human colon tissue Positive IHC detected in: human colon tissue, human colon cancer tissue, human lung cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: A549 cells Positive FC (Intra) detected in: A549 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:500-1:2000 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.20 ug per 10^6 cells in a 100 µl suspension Background Information HPGD, also named as PGDH (15-hydroxyprostaglandin dehydrogenase), a prostaglandin-degrading enzyme that physiologically antagonizes COX-2 (PMID:15574495). HPGD inhibits in vivo proferation of colon cancer cells (PMID:24760190). HPGD has five isoforms with the molecular mass of 29, 21, 19, 16 and 15 kDa. Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Mouse / IgG2b Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag1499 Product name: Recombinant human HPGD protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-266 aa of BC018986 Sequence: MHVNGKVALVTGAAQGIGRAFAEALLLKGAKVALVDWNLEAGVQCKAALDEQFEPQKTLFIQCDVADQQQLRDTFRKVVDHFGRLDILVNNAGVNNEKNWEKTLQINLVSVISGTYLGLDYMSKQNGGEGGIIINMSSLAGLMPVAQQPVYCASKHGIVGFTRSAALAANLMNSGVRLNAICPGFVNTAILESIEKEENMGQYIEYKDHIKDMIKYYGILDPPLIANGLITLIEDDALNGAIMKITTSKGIHFQDYDTTPFQAKTQ Predict reactive species Full Name: hydroxyprostaglandin dehydrogenase 15-(NAD) Calculated Molecular Weight: 29 kDa Observed Molecular Weight: 25-28 kDa GenBank Accession Number: BC018986 Gene Symbol: HPGD Gene ID (NCBI): 3248 RRID: AB_2861358 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P15428 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.