Product Description
Size: 20ul / 150ul
The FFAR3 (66811-1-Ig) by Proteintech is a Monoclonal antibody targeting FFAR3 in WB, IHC, IF/ICC, ELISA applications with reactivity to human samples
66811-1-Ig targets FFAR3 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples.
Tested Applications
Positive WB detected in: HepG2 cells, human adipose tissue, HT-29 cells
Positive IHC detected in: human liver cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0
Positive IF/ICC detected in: A549 cells
Recommended dilution
Western Blot (WB): WB : 1:500-1:3000
Immunohistochemistry (IHC): IHC : 1:200-1:800
Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500
Background Information
FFAR3 (Free fatty acid receptors 3) also known as GPR41, with another GPR43 protein, both are Gai-coupled receptor activated by short-chain fatty acids (SCFAs) such as acetate, propionate, and butyrate (PMID:26870043). GPR41 protein is translated from the bicistronic mRNA encoding GPR40 and GPR41, where an internal ribosome entry site (IRES) is utilized for the GPR41 coding sequence downstream of GPR40 (PMID:22493486). GPR41 is expressed in adipose tissue, gut, and the peripheral nervous system, and it is involved in SCFA-dependent energy regulation(PMID: 24904531).
Specification
Tested Reactivity: human
Cited Reactivity: human, mouse, rat, pig
Host / Isotype: Mouse / IgG1
Class: Monoclonal
Type: Antibody
Immunogen: CatNo: Ag28025 Product name: Recombinant human FFAR3 protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 246-346 aa of BC035657 Sequence: VVGYICGESPAWRIYVTLLSTLNSCVDPFVYYFSSSGFQADFHELLRRLCGLWGQWQQESSMELKEQKGGEEQRADRPAERKTSEHSQGCGTGGQVACAES Predict reactive species
Full Name: free fatty acid receptor 3
Calculated Molecular Weight: 39 kDa
Observed Molecular Weight: 40-48 kDa
GenBank Accession Number: BC035657
Gene Symbol: FFAR3
Gene ID (NCBI): 2865
RRID: AB_2882154
Conjugate: Unconjugated
Form: Liquid
Purification Method: Protein G purification
UNIPROT ID: O14843
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924