Iright
BRAND / VENDOR: Proteintech

Proteintech, 66816-1-Ig, CHAT Monoclonal antibody

CATALOG NUMBER: 66816-1-Ig
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The CHAT (66816-1-Ig) by Proteintech is a Monoclonal antibody targeting CHAT in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 66816-1-Ig targets CHAT in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: Jurkat cells, PC-12 cells, HEK-293 cells, SH-SY5Y cells, Y79 cells, U-251 cells, Neuro-2a cells Positive IHC detected in: mouse small intestine tissue, rat small intestine tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunohistochemistry (IHC): IHC : 1:500-1:2000 Background Information CHAT (choline acetyltransferase) belongs to the carnitine/choline acetyltransferase family. It catalyzes the reversible synthesis of acetylcholine (ACh) from acetyl CoA and choline at cholinergic synapses. Defects in CHAT are the cause of congenital myasthenic syndrome with episodic apnea (CMSEA). CHAT is known to to be present exclusively in the cytoplasm of cholinergic neurons and anti-CHAT antibody has been considered as the best marker for cholinergic neurons. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: mouse Host / Isotype: Mouse / IgG2b Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag19602 Product name: Recombinant human CHAT protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 281-630 aa of BC130617 Sequence: SDTHRALQLLHGGGYSKNGANRWYDKSLQFVVGRDGTCGVVCEHSPFDGIVLVQCTEHLLKHMTQSSRKLIRADSVSELPAPRRLRWKCSPEIQGHLASSAEKLQRIVKNLDFIVYKFDNYGKTFIKKQKCSPDAFIQVALQLAFYRLHRRLVPTYESASIRRFQEGRVDNIRSATPEALAFVRAVTDHKAAVPASEKLLLLKDAIRAQTAYTVMAITGMAIDNHLLALRELARAMCKELPEMFMDETYLMSNRFVLSTSQVPTTTEMFCCYGPVVPNGYGACYNPQPETILFCISSFHSCKETSSSKFAKAVEESLIDMRDLCSLLPPTESKPLATKEKATRPSQGHQP Predict reactive species Full Name: choline acetyltransferase Calculated Molecular Weight: 748 aa, 83 kDa Observed Molecular Weight: 67-71 kDa GenBank Accession Number: BC130617 Gene Symbol: CHAT Gene ID (NCBI): 1103 RRID: AB_2882159 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P28329 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924