Iright
BRAND / VENDOR: Proteintech

Proteintech, 66821-1-Ig, Syntaxin 10 Monoclonal antibody

CATALOG NUMBER: 66821-1-Ig
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The Syntaxin 10 (66821-1-Ig) by Proteintech is a Monoclonal antibody targeting Syntaxin 10 in WB, IF/ICC, ELISA applications with reactivity to Human samples 66821-1-Ig targets Syntaxin 10 in WB, IF/ICC, ELISA applications and shows reactivity with Human samples. Tested Applications Positive WB detected in: HeLa cells, HEK-293 cells, T-47D cells Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information Syntaxin 10 (STX10), also named as SYN10, belongs to the syntaxin family. Syntaxins are target membrane SNAREs(Soluble NSF attachment protein receptors) which are membrane components that determine the specificity of the docking and fusion of vesicles to target membranes. Specification Tested Reactivity: Human Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag27861 Product name: Recombinant human STX10 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-200 aa of BC017237 Sequence: MSLEDPFFVVRGEVQKAVNTARGLYQRWCELLQESAAVGREELDWTTNELRNGLRSIEWDLEDLEETIGIVEANPGKPAAQKSPSDLLDASAVSATSRYIEEQQATQQLIMDEQDQQLEMVSGSIQVLKHMSGRVGEELDEQGIMLDAFAQEMDHTQSRMDGVLRKLAKVSHMTSDRRQWCAIAVLVGVLLLVLILLFSL Predict reactive species Full Name: syntaxin 10 Calculated Molecular Weight: 28 kDa Observed Molecular Weight: 34 kDa GenBank Accession Number: BC017237 Gene Symbol: Syntaxin 10 Gene ID (NCBI): 8677 RRID: AB_2882164 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: O60499 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924