Proteintech, 66822-1-Ig, USP4 Monoclonal antibody

Size: 20ul / 150ul The USP4 (66822-1-Ig) by Proteintech is a Monoclonal antibody targeting USP4 in WB, IHC, IF-P, FC (Intra), ELISA applications with reactivity to human, mouse samples 66822-1-Ig targets USP4 in WB, IHC, IF-P, FC (Intra), IP, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: HeLa cells, Jurkat cells, HEK-293 cells, THP-1 cells, NCI-H1299 cells, RAW 264.7 cells Positive IHC detected in: human breast cancer tissue, mouse kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: human breast cancer tissue, human liver cancer tissue Positive FC (Intra) detected in: THP-1 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Immunohistochemistry (IHC): IHC : 1:100-1:300 Immunofluorescence (IF)-P: IF-P : 1:50-1:500 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension Background Information USP4, also named as UNP and UNPH, belongs to the peptidase C19 family and USP4 subfamily. USP4 is a deubiquitinating enzyme that links to mitogen-activated protein kinase signaling, pre-mRNA splicing, and control of p53 stability (PMID: 26455393). USP4 has 3 isoforms with the molecular mass of 36, 104 and 109 kDa. Recently, it has been reported that USP4 is a critical factor in promoting lung cancer stemness and potentially useful lung cancer prognosis marker (PMID: 32549341). Specification Tested Reactivity: human, mouse Cited Reactivity: human, mouse Host / Isotype: Mouse / IgG2b Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag28297 Product name: Recombinant human USP4 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 567-779 aa of BC125131 Sequence: VCSTSVDGSECVTLPVYFRERKSRPSSTSSASALYGQPLLLSVPKHKLTLESLYQAVCDRISRYVKQPLPDEFGSSPLEPGACNGSRNSCEGEDEEEMEHQEEGKEQLSETEGSGEDEPGNDPSETTQKKIKGQPCPKRLFTFSLVNSYGTADINSLAADGKLLKLNSRSTLAMDWDSETRRLYYDEQESEAYEKHVSMLQPQKKKKTTVALR Predict reactive species Full Name: ubiquitin specific peptidase 4 (proto-oncogene) Calculated Molecular Weight: 963 aa, 109 kDa Observed Molecular Weight: 109 kDa GenBank Accession Number: BC125131 Gene Symbol: USP4 Gene ID (NCBI): 7375 RRID: AB_2882165 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q13107 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.