Proteintech, 66828-1-Ig, VEGFA Monoclonal antibody

Size: 20ul / 150ul The VEGFA (66828-1-Ig) by Proteintech is a Monoclonal antibody targeting VEGFA in WB, IHC, IF/ICC, IF-P, FC (Intra), ELISA applications with reactivity to human samples 66828-1-Ig targets VEGFA in WB, IHC, IF/ICC, IF-P, FC (Intra), ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: MCF-7 cells, HUVEC cells, NCI-H1299 cells, A431 cells, SH-SY5Y cells, HuH-7 cells, T-47D cells, MDA-MB-231 cells Positive IHC detected in: human lung cancer tissue, human colon cancer tissue, human liver cancer tissue, human pancreas cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: human endometrial cancer tissue, human lung cancer tissue Positive IF/ICC detected in: MCF-7 cells Positive FC (Intra) detected in: MCF-7 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunohistochemistry (IHC): IHC : 1:500-1:2000 Immunofluorescence (IF)-P: IF-P : 1:200-1:800 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.50 ug per 10^6 cells in a 100 µl suspension Background Information VEGFA, also named as VEGF or VPF, belongs to the PDGF/VEGF growth factor family. It is a growth factor active in angiogenesis, vasculogenesis and endothelial cell growth. VEGFA induces endothelial cell proliferation, promotes cell migration, inhibits apoptosis and induces permeabilization of blood vessels. It binds to the FLT1/VEGFR1 and KDR/VEGFR2 receptors, heparan sulfate and heparin. Defects in VEGFA are associated with microvascular complications of diabetes type 1 (MVCD1). VEGFA has 17 isoforms with MW from 16 to 45 kDa. Some isoforms have homodimer forms (e.g.; VEGFA189 38kDa or VEFGA110 34 kDa). VEGF-A exists in at least seven homodimeric isoforms. The monomers consist of 121, 145, 148, 165, 183, 189, or 206 amino acids (PMID:15602010 ). This antibody can recognize all VEGFA isoforms. Specification Tested Reactivity: human Cited Reactivity: human, rat, pig, rabbit, zebrafish, goat Host / Isotype: Mouse / IgG2b Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag13500 Product name: Recombinant human VEGFA protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-302 aa of BC065522 Sequence: AAASRGQGPEPAPGGGVEGVGARGVALKLFVQLLGCSRFGGAVVRAGEAEPSGAARSASSGREEPQPEEGEEEEEKEEERGPQWRLGARKPGSWTGEAAVCADSAPAARAPQALARASGRGGRVARRGAEESGPPHSPSRRGSASRAGPGRASETMNFLLSWVHWSLALLLYLHHAKWSQAAPMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQEKCDKPRR Predict reactive species Full Name: vascular endothelial growth factor A Calculated Molecular Weight: 412 aa, 46 kDa Observed Molecular Weight: 43 kDa GenBank Accession Number: BC065522 Gene Symbol: VEGFA Gene ID (NCBI): 7422 RRID: AB_2882171 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P15692 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.