Proteintech, 66833-1-Ig, AGER/RAGE Monoclonal antibody

Size: 20ul / 150ul The AGER/RAGE (66833-1-Ig) by Proteintech is a Monoclonal antibody targeting AGER/RAGE in WB, IHC, IF-P, ELISA applications with reactivity to human, mouse, rat, pig samples 66833-1-Ig targets AGER/RAGE in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse, rat, pig samples. Tested Applications Positive WB detected in: pig lung tissue, rat lung tissue Positive IHC detected in: human lung tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: rat lung tissue, mouse lung tissue Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Immunohistochemistry (IHC): IHC : 1:150-1:600 Immunofluorescence (IF)-P: IF-P : 1:400-1:1600 Background Information Advanced glycosylation end product-specific receptor (AGER, also known as RAGE) is a multiligand receptor of the immunoglobulin superfamily. It interacts with distinct molecules implicated in homeostasis, development, and inflammation, and certain diseases such as diabetes and Alzheimer disease. Specification Tested Reactivity: human, mouse, rat, pig Cited Reactivity: human, mouse, rat Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag9657 Product name: Recombinant human AGER protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 26-340 aa of BC020669 Sequence: ITARIGEPLVLKCKGAPKKPPQRLEWKLNTGRTEAWKVLSPQGGGPWDSVARVLPNGSLFLPAVGIQDEGIFRCQAMNRNGKETKSNYRVRVYQIPGKPEIVDSASELTAGVPNKVGTCVSEGSYPAGTLSWHLDGKPLVPNEKGVSVKEQTRRHPETGLFTLQSELMVTPARGGDPRPTFSCSFSPGLPRHRALRTAPIQPRVWEPVPLEEVQLVVEPEGGAVAPGGTVTLTCEVPAQPSPQIHWMKDGVPLPLPPSPVLILPEIGPQDQGTYSCVATHSSHGPQESRAVSISIIEPGEEGPTAGSVGGSGLGT Predict reactive species Full Name: advanced glycosylation end product-specific receptor Calculated Molecular Weight: 404 aa, 43 kDa Observed Molecular Weight: 45 kDa GenBank Accession Number: BC020669 Gene Symbol: AGER Gene ID (NCBI): 177 RRID: AB_2882176 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: Q15109 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.