Proteintech, 66834-1-Ig, VAP1/AOC3 Monoclonal antibody

Size: 20ul / 150ul The VAP1/AOC3 (66834-1-Ig) by Proteintech is a Monoclonal antibody targeting VAP1/AOC3 in WB, IHC, IF-P, ELISA applications with reactivity to human samples 66834-1-Ig targets VAP1/AOC3 in WB, IHC, IF-P, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: human ileum tissue Positive IHC detected in: human liver cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: human liver cancer tissue Recommended dilution Western Blot (WB): WB : 1:3000-1:8000 Immunohistochemistry (IHC): IHC : 1:500-1:1200 Immunofluorescence (IF)-P: IF-P : 1:200-1:800 Background Information AOC3(membrane primary amine oxidase) is also name as copper amine oxidase, HPAO, SSAO, VAP1 and belongs to the copper/topaquinone oxidase family. It is expressed on the surface of endothelial cells and is involved in leukocyte trafficking between blood and tissues under physiologic and pathologic conditions (PMID:17947691). AOC3 is highly expressed in adipocytes and smooth muscle cells and it can be N- and O-glycosylated (PMID:16046623). AOC3 has molecular mass of 70-90kD, and can exsit as a homodimer(165-185kD) and trimer(240~260kD) (PMID:10595925, 8625974). Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag5908 Product name: Recombinant human AOC3 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 408-763 aa of BC050549 Sequence: ATYVDWHFLLESQAPKTIRDAFCVFEQNQGLPLRRHHSDLYSHYFGGLAETVLVVRSMSTLLNYDYVWDTVFHPSGAIEIRFYATGYISSAFLFGATGKYGNQVSEHTLGTVHTHSAHFKVDLDVAGLENWVWAEDMVFVPMAVPWSPEHQLQRLQVTRKLLEMEEQAAFLVGSATPRYLYLASNHSNKWGHPRGYRIQMLSFAGEPLPQNSSMARGFSWERYQLAVTQRKEEEPSSSSVFNQNDPWAPTVDFSDFINNETIAGKDLVAWVTAGFLHIPHAEDIPNTVTVGNGVGFFLRPYNFFDEDPSFYSADSIYFRGDQDAGACEVNPLACLPQAAACAPDLPAFSHGGFSHN Predict reactive species Full Name: amine oxidase, copper containing 3 (vascular adhesion protein 1) Calculated Molecular Weight: 85 kDa Observed Molecular Weight: 85-90 kDa GenBank Accession Number: BC050549 Gene Symbol: AOC3 Gene ID (NCBI): 8639 RRID: AB_2882177 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: Q16853 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.