Iright
BRAND / VENDOR: Proteintech

Proteintech, 66849-1-Ig, CPLX2 Monoclonal antibody

CATALOG NUMBER: 66849-1-Ig
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The CPLX2 (66849-1-Ig) by Proteintech is a Monoclonal antibody targeting CPLX2 in WB, IHC, FC (Intra), ELISA applications with reactivity to human, mouse, rat, pig samples 66849-1-Ig targets CPLX2 in WB, IHC, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat, pig samples. Tested Applications Positive WB detected in: mouse brain tissue, mouse cerebellum tissue, rat brain tissue, rat cerebellum tissue Positive IHC detected in: mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive FC (Intra) detected in: SH-SY5Y cells Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Immunohistochemistry (IHC): IHC : 1:250-1:1000 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension Background Information Complexins are soluble proteins that regulate the activity of soluble N-ethylmaleimide-sensitive factor attachment protein receptor (SNARE) complexes necessary for vesicle fusion. Neuronal specific complexin 1 (CPLX1) has inhibitory and stimulatory effects on exocytosis by clamping trans-SNARE complexes in a prefusion state and promoting conformational changes to facilitate membrane fusion following cell stimulation. Complexin2 (CPLX2) is a pre-synaptic protein believed to regulate neurotransmitter release from pre-synaptic terminals, it is downregulated in schizophrenic patients suffering from depression, animal models of depression and neurological disorders such as Huntington's disease in which depression is a major symptom. Specification Tested Reactivity: human, mouse, rat, pig Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag27949 Product name: Recombinant human CPLX2 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-134 aa of BC093706 Sequence: MDFVMKQALGGATKDMGKMLGGEEEKDPDAQKKEEERQEALRQQEEERKAKHARMEAEREKVRQQIRDKYGLKKKEEKEAEEKAALEQPCEGSLTRPKKAIPAGCGDEEEEEEESILDTVLKYLPGPLQDMFKK Predict reactive species Full Name: complexin 2 Calculated Molecular Weight: 134 aa, 15 kDa Observed Molecular Weight: 18-20 kDa GenBank Accession Number: BC093706 Gene Symbol: CPLX2 Gene ID (NCBI): 10814 RRID: AB_2882189 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: Q6PUV4 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924