Proteintech, 66858-1-Ig, CYLD Monoclonal antibody

Size: 20ul / 150ul The CYLD (66858-1-Ig) by Proteintech is a Monoclonal antibody targeting CYLD in WB, IF/ICC, ELISA applications with reactivity to Human, mouse, rat, pig, rabbit samples 66858-1-Ig targets CYLD in WB, IF/ICC, ELISA applications and shows reactivity with Human, mouse, rat, pig, rabbit samples. Tested Applications Positive WB detected in: pig brain tissue, HEK-293 cells, A431 cells, rat brain tissue, mouse brain tissue, rabbit brain tissue Positive IF/ICC detected in: SH-SY5Y cells Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information CYLD, also named as CYLD1, belongs to the peptidase C67 family. It is the protease that specifically cleaves 'Lys-63'-linked polyubiquitin chains. CYLD has endodeubiquitinase activity and plays an important role in the regulation of pathways leading to NF-kappa-B activation. CYLD contributes to the regulation of cell survival, proliferation and differentiation via its effects on NF-kappa-B activation. It is a negative regulator of Wnt signaling. CYLD inhibits HDAC6 and thereby promotes acetylation of alpha-tubulin and stabilization of microtubules. CYLD plays a role in the regulation of microtubule dynamics, and thereby contributes to the regulation of cell proliferation, cell polarization, cell migration, and angiogenesis. It is required for normal cell cycle progress and normal cytokinesis. CYLD inhibits nuclear translocation of NF-kappa-B and plays a role in the regulation of inflammation and the innate immune response, via its effects on NF-kappa-B activation. It is dispensable for the maturation of intrathymic natural killer cells, but required for the continued survival of immature natural killer cells. CYLD negatively regulates TNFRSF11A signaling and osteoclastogenesis. Specification Tested Reactivity: Human, mouse, rat, pig, rabbit Host / Isotype: Mouse / IgG2a Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag28333 Product name: Recombinant human CYLD protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 654-953 aa of BC012342 Sequence: TKIMKLRKILEKVEAASGFTSEEKDPEEFLNILFHHILRVEPLLKIRSAGQKVQDCYFYQIFMEKNEKVGVPTIQQLLEWSFINSNLKFAEAPSCLIIQMPRFGKDFKLFKKIFPSLELNITDLLEDTPRQCRICGGLAMYECRECYDDPDISAGKIKQFCKTCNTQVHLHPKRLNHKYNPVSLPKDLPDWDWRHGCIPCQNMELFAVLCIETSHYVAFVKYGKDDSAWLFFDSMADRDGGQNGFNIPQVTPCPEVGEYLKMSLEDLHSLDSRRIQGCARRLLCDAYMCMYQSPTMSLYK Predict reactive species Full Name: cylindromatosis (turban tumor syndrome) Calculated Molecular Weight: 107 kDa Observed Molecular Weight: 110 kDa GenBank Accession Number: BC012342 Gene Symbol: CYLD Gene ID (NCBI): 1540 RRID: AB_2882197 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q9NQC7 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.