Iright
BRAND / VENDOR: Proteintech

Proteintech, 66865-1-Ig, CCNY Monoclonal antibody

CATALOG NUMBER: 66865-1-Ig
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The CCNY (66865-1-Ig) by Proteintech is a Monoclonal antibody targeting CCNY in WB, ELISA applications with reactivity to Human, Rat, Mouse samples 66865-1-Ig targets CCNY in WB, IF, ELISA applications and shows reactivity with Human, Rat, Mouse samples. Tested Applications Positive WB detected in: HeLa cells, NIH/3T3 cells, RAW 264.7 cells, A549 cells, HEK-293 cells, HepG2 cells, Jurkat cells, HSC-T6 cells Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Background Information CCNY, also named as C10orf9, CBCP1, CFP1, is a novel cyclin. CCNY acts as a cell-cycle regulator of Wnt signaling pathway during G2/M phase by recruiting CDK14/PFTK1 to the plasma membrane and promoting phosphorylation of LRP6, leading to the activation of the Wnt signaling pathway. Specification Tested Reactivity: Human, Rat, Mouse Cited Reactivity: mouse Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag12691 Product name: Recombinant human CCNY protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-287 aa of BC104773 Sequence: MEFNPSDHPRASTIFLSKSQTDVREKRKSLFINHHPPGQIARKYSSCSTIFLDDSTVSQPNLKYTIKCVALAIYYHIKNRDPDGRMLLDIFDENLHPLSKSEVPPDYDKHNPEQKQIYRFVRTLFSAAQLTAECAIVTLVYLERLLTYAEIDICPANWKRIVLGAILLASKVWDDQAVWNVDYCQILKDITVEDMNELERQFLELLQFNINVPSSVYAKYYFDLRSLAEANNLSFPLEPLSRERAHKLEAISRLCEDKYKDLRRSARKRSASADNLTLPRWSPAIIS Predict reactive species Full Name: cyclin Y Calculated Molecular Weight: 33 kDa, 39 kDa Observed Molecular Weight: 37 kDa GenBank Accession Number: BC104773 Gene Symbol: CCNY Gene ID (NCBI): 219771 RRID: AB_2882202 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: Q8ND76 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924